KEGG   Corynebacterium argentoratense: CARG_01250Help
Entry
CARG_01250        CDS       T02821                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
caz  Corynebacterium argentoratense
Brite
KEGG Orthology (KO) [BR:caz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:caz03012]
    CARG_01250
   03029 Mitochondrial biogenesis [BR:caz03029]
    CARG_01250
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:caz04147]
    CARG_01250
Translation factors [BR:caz03012]
 Eukaryotic Type
  Elongation factors
   CARG_01250
 Prokaryotic Type
   CARG_01250
Mitochondrial biogenesis [BR:caz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CARG_01250
Exosome [BR:caz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CARG_01250
  Exosomal proteins of breast cancer cells
   CARG_01250
  Exosomal proteins of colorectal cancer cells
   CARG_01250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 16729037
NCBI-ProteinID: AGU14439
UniProt: U3GT01
LinkDB All DBs
Position
252135..253328
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLADEYPELNQAFAFDAIDKAPEEKE
RGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDSPDVDDEMIELVEMEVREMLAEQEYDEDAPIIQVSALKA
LEGDPEWTAKIVELMKACDEKIPDPERETDKPFLMPIEDIFTITGRGTVVTGRVERGKLN
VNDEVEILGIREKSTKTTVTGIEMFRKLLDYTEAGDNCGLLLRGIKREDVERGQIVAAPG
AYTPHTEFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNV
DMSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtacaaagccgcacgtcaacatcggtaccattggtcac
gtcgaccacggtaagaccaccctgaccgcagccatcaccaaggttctggctgacgagtac
ccggagctgaaccaggctttcgctttcgacgctattgacaaggcgccggaagaaaaggag
cgtggtatcacgattaacatctcccacgtcgagtaccagaccgagaagcgccactacgct
cacgtggacgcccccggccacgctgactacatcaagaacatgatcaccggtgctgctcag
atggacggcgcaatcctcgtggttgccgctaccgacggcccgatgcctcagacccgtgag
cacgttcttcttgctcgccaggttggcgttccctacatcctcgttgctctgaacaagtgt
gactccccggatgttgacgacgagatgatcgagctcgtcgagatggaagttcgcgaaatg
cttgctgagcaggagtacgacgaggacgctcccatcattcaggtttccgcactgaaggct
ctcgagggtgaccccgagtggaccgctaagatcgttgagctcatgaaggcttgcgacgag
aagattccggatccggagcgcgagaccgacaagcccttcctcatgcccatcgaggacatc
ttcaccattaccggtcgcggcaccgtcgttaccggtcgtgttgagcgcggcaagttgaac
gtcaacgacgaggtcgagattctcggtatccgcgagaagtccaccaagaccaccgttacc
ggtatcgagatgttccgcaagctcctcgactacaccgaggctggcgacaactgtggtctg
ctgctccgtggtatcaagcgtgaggacgtcgagcgcggccagatcgttgctgctcccggc
gcttacacccctcacaccgagttcgagggctccgtctacatcctttccaaggatgagggc
ggccgccacaccccgttcttcgacaactaccgtcctcagttctacttccgcaccaccgac
gttaccggtgttgtgaagcttcctgagggcaccgagatggtcatgcctggcgacaacgtc
gacatgtccgtcaccctgatccagccggtcgctatggacgagggcctccgcttcgctatc
cgcgaaggtggccgcaccgtcggcgctggccgcgtcaccaagatcatcaagtaa

DBGET integrated database retrieval system