KEGG   Clostridium botulinum A ATCC 19397: CLB_1139Help
Entry
CLB_1139          CDS       T00574                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00010  Glycolysis / Gluconeogenesis
cba00053  Ascorbate and aldarate metabolism
cba00071  Fatty acid degradation
cba00280  Valine, leucine and isoleucine degradation
cba00310  Lysine degradation
cba00330  Arginine and proline metabolism
cba00340  Histidine metabolism
cba00380  Tryptophan metabolism
cba00410  beta-Alanine metabolism
cba00561  Glycerolipid metabolism
cba00620  Pyruvate metabolism
cba00625  Chloroalkane and chloroalkene degradation
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba01130  Biosynthesis of antibiotics
Module
cba_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLB_1139
   00053 Ascorbate and aldarate metabolism
    CLB_1139
   00620 Pyruvate metabolism
    CLB_1139
  Lipid metabolism
   00071 Fatty acid degradation
    CLB_1139
   00561 Glycerolipid metabolism
    CLB_1139
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLB_1139
   00310 Lysine degradation
    CLB_1139
   00330 Arginine and proline metabolism
    CLB_1139
   00340 Histidine metabolism
    CLB_1139
   00380 Tryptophan metabolism
    CLB_1139
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLB_1139
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLB_1139
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLB_1139
Enzymes [BR:cba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CLB_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ABS33306
LinkDB All DBs
Position
1180917..1182287
Genome map
AA seq 456 aa AA seqDB search
MENIRNILEKQKSFFDKGYTKDINFRIEALKKLKHNIKINENNIFKALKIDLNKSEFETF
ITEIGIVYDEINGAIKNIKKWSKPKKVKTPITNFLASSYIYNEPYGVALIMSPWNYPFQL
IMAPLVGAISAGNCVLLKPSELAIETEKIIVKIIKDTFSDEYIGVITGGIEESTALLKEK
FDYIFYTGGINVGKIVMRAAAEHLTPITLELGGKSPCIVDKDANIDLAARRIAWGKFLNA
GQTCVAPDYLVVHRNIKEKLISSIENYIIEFFGENTFESEDYPRIINERHFKRLEGYLKE
GKIVSGGNTDINNLYIEPTIIEGINFENRIMEEEIFGPVFPVIEFENIDKVIEIVKNNPK
PLALYYFSENKEKQEFIIKNISFGGGCINDTIMHLSTSTLPFGGVGNSGIGGYHGRASFD
TFSHKKSILKKSNLIDVKIRYAPFKGKINLAKRLFK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggagaatataagaaatatattggaaaaacagaagagtttttttgataagggatataca
aaggatattaactttagaatagaggctttaaaaaaattaaaacataatataaaaatcaat
gaaaacaatatatttaaagctttaaagatagatttaaataaatcagaatttgaaacattt
ataacagaaataggtattgtatatgatgaaataaatggagcgattaaaaatataaaaaaa
tggtcaaagcctaaaaaagtaaaaactccaattactaattttttagctagtagttatata
tacaatgagccttacggtgtagctttaataatgtctccctggaattatccatttcaactt
attatggctcctttagtaggagctataagtgctggtaattgtgttttgttaaagccctcc
gaattagcaatagaaacggaaaaaataatagttaaaataataaaagatacattttctgat
gaatatataggggttatcactggaggaatagaagagagtacggctttgcttaaagaaaag
tttgactatatattttatacgggtggaataaatgtaggtaaaatagttatgagagcagct
gcagagcatttaacccccataaccttagaattaggagggaaaagtccctgcattgttgac
aaggatgctaacatagatttggctgccagaagaatagcttggggaaaatttttaaatgct
ggacaaacctgtgtagcaccagattatttagtagtgcatagaaatataaaagaaaaatta
ataagttcaatagaaaattatataattgagttttttggagaaaatacctttgaaagtgaa
gattatcctagaataataaatgaaagacactttaaaagattagaaggatatttaaaggaa
ggaaaaatagtttctggaggaaatacagatataaataatttatatatagaaccaactatt
atagaaggaataaattttgaaaatagaataatggaggaagaaatatttggccctgttttc
ccagttatagaatttgaaaacatagataaagttatagaaatagtaaaaaataatcctaaa
ccactagcactatattatttttctgagaataaagagaaacaggaatttattattaaaaat
atatcctttggcgggggatgtataaatgatactataatgcatttgtctacttctacatta
ccctttggtggtgtaggtaatagtgggataggaggctatcatggcagagcaagttttgac
acattttctcataaaaaaagtatacttaaaaagagtaatttaatagatgtaaaaataaga
tatgcaccttttaaaggaaaaataaatttagcaaaaagattatttaagtaa

DBGET integrated database retrieval system