KEGG   Clostridium botulinum A ATCC 19397: CLB_1854Help
Entry
CLB_1854          CDS       T00574                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cba  Clostridium botulinum A ATCC 19397
Pathway
cba00250  Alanine, aspartate and glutamate metabolism
cba00410  beta-Alanine metabolism
cba00430  Taurine and hypotaurine metabolism
cba00650  Butanoate metabolism
cba01100  Metabolic pathways
cba01110  Biosynthesis of secondary metabolites
cba01120  Microbial metabolism in diverse environments
cba02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CLB_1854
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLB_1854
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLB_1854
   00430 Taurine and hypotaurine metabolism
    CLB_1854
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLB_1854
Enzymes [BR:cba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CLB_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABS33386
LinkDB All DBs
Position
1965621..1967024
Genome map
AA seq 467 aa AA seqDB search
MLYSSKNKQSNDTYATPIFGITKDKYSIPKYKINENSIAPNIAYRMIKDELMNEGNARLN
LATFCQTYMEDKATKLMAETLQKNAIDKSEYPQTAEIENRCVNIISDLWNVPKDMNFLGT
STVGSSEACMLGGMSMKFRWRDQAKKLGIDINKKKPNLVISSGYQVCWEKFCVYWDIEMR
TVPMDEDNLSLNIDKILDYVDEYTIGIIGILGITYTGKFDDIKALDDAIEKYNSNHDIKV
YIHVDAASGGFFTPFINPEILWDFRLKNVVSINASGHKYGLVYPGIGWILWKDQEYLPKD
LIFEVSYLGGKMPTLAINFSRSGSQIIGQYYNFLRFGFEGYKKIHERTKEVAMYISKELE
ATGLFSIYNDGSNLPIVCYKLKEQSKVKWNLYDLSDRLAMKGWQIPAYPLPENLNHIIIQ
RIVCRSDLGYNLAELLIKDFKTAINDLNNAHILFHEEENQGIYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctctattcttcaaaaaacaagcaaagtaatgatacctatgctacccctatttttggt
atcactaaggacaagtattcaattcctaagtacaaaattaatgaaaattctattgcacct
aatatagcctatcgtatgattaaagatgaacttatgaatgaaggtaacgcacgcttaaat
ttagctactttttgtcagacctatatggaagataaagctaccaaacttatggctgaaacc
ttacaaaaaaatgctatcgacaagtctgaatatccacaaactgccgaaatagagaatcgc
tgtgttaatattatttcagatctttggaatgtcccaaaggatatgaacttcttaggtacc
tctactgtgggttcttcagaagcttgtatgttaggtggcatgtctatgaaattccgttgg
cgtgatcaggctaaaaaattaggtattgatattaacaagaagaaacctaacttggtaata
tcatctggttatcaggtatgttgggaaaaattctgtgtatattgggatattgaaatgcgt
accgttcctatggatgaggataatctaagtttaaatatagataagattcttgattatgta
gatgaatatactataggaattataggtattttaggtataacttatacgggtaaatttgat
gatattaaagcattagatgatgccattgaaaaatataatagtaatcatgatataaaggta
tatattcatgtagatgctgcctctggtggctttttcaccccatttattaatccagaaatt
ttgtgggattttcgtctaaaaaatgtagtttctataaatgcatccggtcataaatatgga
ttagtgtatccaggaataggttggattctgtggaaggatcaagaatatcttcctaaagat
ttaatatttgaagtaagttatttgggtggcaaaatgccaaccttagctattaatttttct
agatctggaagtcaaatcataggacaatattataatttcctacgctttggttttgaagga
tataaaaaaattcatgaacgcacaaaagaggtagctatgtatatttcaaaagagcttgaa
gctacaggattattcagtatatataatgatggcagtaatcttcctatagtttgttataaa
ctaaaggaacaatctaaggtaaaatggaatctttatgatttatcagatagactagctatg
aaaggctggcaaataccagcttaccctctccctgaaaatcttaaccatataataatacaa
agaatagtttgtcgttcagacctaggatataatttagcagaactattgataaaagatttt
aaaacagcaataaatgatttgaataatgctcatatattatttcatgaagaagaaaaccaa
ggtatttatggatttactcattaa

DBGET integrated database retrieval system