KEGG   Clostridium botulinum A ATCC 19397: CLB_2377Help
Entry
CLB_2377          CDS       T00574                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cba  Clostridium botulinum A ATCC 19397
Brite
KEGG Orthology (KO) [BR:cba00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cba01001]
    CLB_2377
Enzymes [BR:cba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CLB_2377
Protein kinases [BR:cba01001]
 Serine/threonine kinases: Other
  Bacterial family
   CLB_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 CD99L2 ETRAMP Kdo PBP1_TM Trypan_PARP Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ABS32582
LinkDB All DBs
Position
complement(2511037..2512980)
Genome map
AA seq 647 aa AA seqDB search
MIGTKLGNRYELLEKVGEGGMATVYKAKCHYLNRFVAIKILKEQFCSDKEFVEKFKREAT
SVASLSDNNIVNIYDVGSENNIHYIVMEYVDGKTLKELIVEKGKIDPKETVRISKQIASA
LVCAHRNNIIHRDIKPHNILVTKEGIVKVTDFGIAKASNSATITNSSKVMGSAHYFSPEQ
AKGSFVDSRTDIYSLGIVMYEMLVGKVPFDGESPVSVAVKHIQNEVVAPKEIDDKIPESL
NSLVLKCLEKNPVKRYQTIKNLEEDLARIENNENILNGSSNISENDVTRVMDTAVINDKI
KEMAQNDEYEDDDEEYEDDDEEIEDKKKRSNKGKTNKKLILGIAMAVLFLVVGSVSAYLA
FNKSGGKKVEVPNVVGLTKEEAEKVLSEKKLKLVVAQKVKNEKKEGTIIESYPKSGEKVA
ENSEVRVSISSGNVVVVPNLKGMELEAAKKAIQDLKLKVGNVKYEFNDNVASGKVISQTP
DIDAELKEGEEISLVISNGPEIKYSTVPNLIGKSIDGAQNALANAGLSMGGSKAIITEDQ
SLDGQVASQSIGAGQSIKQGSSVSISYYKYKKPEPKPDPKPDTDTGKDPGTDTGKNPGTD
TGKDPGTDTGKDPGTDTGKDPGTDPGTDTGKDPGTDTGKDSGTTPKK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaccaaattaggtaataggtatgaacttcttgaaaaagttggagagggtggt
atggctacagtttataaagctaaatgccattacctaaatagatttgtcgcaataaagata
ttaaaagagcaattttgcagtgacaaagaatttgtagaaaaatttaaaagagaagcaact
tcagtagcgagcttatcagataacaatatagtaaatatttatgatgtaggttctgaaaat
aatatacattatatagttatggaatatgtagatggtaaaactttaaaggaattaatagta
gaaaaagggaaaattgatcctaaggaaactgttagaatatcaaaacaaatagctagtgct
ttggtttgtgctcatagaaacaatattatacatagagatataaaaccacacaatatatta
gttacaaaagaaggaattgttaaggttacagattttggtatagcaaaggcttcaaattca
gctactataacaaattctagtaaagtaatgggatcagctcattatttttcaccagaacaa
gctaaaggaagttttgtggactcaagaactgatatatattctttaggtatagtaatgtat
gaaatgcttgtgggaaaagttccattcgatggagagagccctgtatctgtagcagtaaag
catatacaaaatgaagtagtagcaccaaaagaaatagatgataaaattccagaaagttta
aatagtttagtactaaagtgcttggaaaaaaatcctgtaaaaagatatcaaactataaaa
aatttagaagaggacttagctagaatagaaaataatgaaaatatattaaatggatctagc
aatatatcagaaaacgatgttactagagtaatggacacagcggttataaatgacaaaata
aaagaaatggctcaaaatgatgagtatgaagatgatgatgaggaatatgaagatgatgat
gaggaaatagaggataaaaagaaaagaagtaataagggtaaaacaaataaaaaattaata
ttaggaatagctatggcagttttatttctagttgtaggatctgtatctgcatacttggcc
ttcaataaatcaggagggaaaaaggtagaagttcctaatgtagtaggacttactaaagaa
gaagcggaaaaggtattaagtgagaaaaaattaaaattagtagtagctcaaaaggttaaa
aatgaaaaaaaggaaggaactataatagaatcttatccaaaatccggtgaaaaagtagca
gaaaattccgaagtaagagttagtataagttctgggaatgtagtagttgtgcctaattta
aagggaatggaattagaggccgctaaaaaagcaatacaagatcttaaattaaaagtaggg
aatgtaaaatatgaatttaatgacaatgtagcttctggaaaagtaataagtcaaactcca
gatatagatgcagaattaaaagaaggagaagaaattagtttagttataagtaatggtcca
gaaattaaatactcaacagtacctaacttaataggaaaatctatagatggagctcaaaat
gctttagctaatgcaggactatctatgggaggctcaaaggctattattacagaagatcaa
tccttagatggccaagtggcatcacaaagcataggtgcaggacaaagcataaaacaaggt
tcttccgtaagtatatcctattataaatacaaaaaaccagaaccaaaaccagacccaaaa
ccagatacagatacaggtaaggatccaggaacagacacaggtaagaatccaggaacagac
acaggtaaggacccaggaacagatacaggcaaggatccaggaacagatacaggtaaggat
ccaggaacagatccaggaacagatacaggcaaggatccaggaacagacacaggtaaggat
tcaggaactactcctaaaaaataa

DBGET integrated database retrieval system