KEGG   Serpentinomonas raichei: SRAA_0029Help
Entry
SRAA_0029         CDS       T03614                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbaa  Serpentinomonas raichei
Pathway
cbaa00564  Glycerophospholipid metabolism
cbaa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SRAA_0029
Enzymes [BR:cbaa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SRAA_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox_2 GIDA FAD_binding_3 Lycopene_cycl Thi4 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAO79883
UniProt: A0A060NKE2
LinkDB All DBs
Position
30694..32256
Genome map
AA seq 520 aa AA seqDB search
MWDLLVVGGGATGLGVALEAAQRGWRVALLESHDFAGGTSSRSTKLLHGGVRYLAQGNLA
LVREALAERQAVLHIAPHLAQPLPFVMPCYRPWQAPFYGAGLKLYDWLAGSAGLGRTRWL
GREQALAALPGVQAQGLLGGIQYWDAQFEDARLALALARSAEAAGAVLLNYVEVQQVQRV
AAAGAAQANQVMQVQALDRHGGGRLQLQARCVVNATGVWVDGLRQTLQPEAAPLVRPSQG
VHLVVARDFLPRQQALLVPRTADGRVLFAVPWLGALVLGSTDTPRADLPREPEPFEAEIE
FILREASLALARPVRRTDVKSVWVGLRPLVAAASAGANTKTLSREHRIVVDRSGLVTVTG
GKWTTFRAMASDVLAHCVEAGLLAPRPALANPTAPLCGAVVAGAGSAATRVPQPLHQAPG
LHLYGNHAAAVQAMPGAERMLGLGLTEAMVRYAVRHEWALTVEDVLARRWRALFLDAAAA
EGMAAAVAQIVQDELQRAAAPHTDPELPAFVALAQRYQLQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggatttgcttgtcgtcggcggcggagccaccggcttgggcgtggcgctggaggcg
gcgcagcgcggctggcgcgtggcgctgctggaatcgcacgactttgccggcggcacctcc
tcgcgctcgaccaagctgctgcacggcggcgtgcgctatctggcgcaaggcaatctggcc
ctggtgcgcgaggcgctggccgagcgccaggcggtgctgcacatcgcgccgcatctggcg
cagccgctgcccttcgtgatgccgtgctaccgcccctggcaagcgcctttttatggggcc
gggctcaagctctacgactggctggcgggcagcgccggcttgggccgcacgcgctggctg
ggccgcgagcaggcgcttgcggcgctgccgggggtgcaggcccaagggctgctgggcggc
atccagtactgggatgcccagttcgaagacgcccggctggcgctggcgctggcgcgcagc
gccgaagccgccggggcggtgttgctgaactacgtggaggtgcagcaggtgcagcgcgtt
gctgccgctggtgctgcgcaggccaaccaagtgatgcaggtgcaggcgcttgatcgccac
gggggagggcggctgcaactgcaggcgcgctgcgtcgtcaatgccaccggggtctgggtg
gatgggctgcgccagaccctgcagcccgaagccgcgccactggtccggcccagccaaggg
gtgcacctggtggtggcgcgcgatttcctgcctaggcagcaggcgctgctggtgccgcgc
accgccgatggccgggtcttgttcgccgtgccgtggctgggcgcactggtgctgggcagc
accgacacgccgcgcgccgatctgccacgcgaacccgagccgttcgaggccgaaatcgaa
ttcatcttgcgcgaggcttcgttggcgctggcgcgtccggtgcggcgcaccgatgtgaag
agcgtctgggtcggattgcggccgctggtggcggcggcgtcggccggggccaacaccaaa
accctgtcgcgcgagcaccgcatcgtcgtcgatcgctcaggactggtcacagtcacgggg
ggcaagtggaccactttccgcgccatggccagcgatgtgctggcgcactgcgtggaggct
ggcctgctggccccgcgccccgccttggccaatccgactgcccccttgtgcggggccgtg
gttgcaggagcgggttcggctgcaacgcgggtgccgcagcccctgcaccaggcgccgggt
ttgcatctgtatggcaaccacgccgccgccgtgcaagccatgcccggtgccgagcgcatg
ctggggctgggcctgaccgaggccatggtgcgctacgccgtgcgccacgagtgggcgctg
acggtagaagacgtgctggcgcggcgctggcgcgcgctgttcctagacgccgccgccgcc
gagggcatggccgcagccgtggcgcaaatcgtgcaagacgagctgcagcgcgccgctgcg
ccccacaccgaccccgaattgcccgcctttgtggcgctggcgcaacgctaccagctgcag
tag

DBGET integrated database retrieval system