KEGG   Serpentinomonas raichei: SRAA_0268Help
Entry
SRAA_0268         CDS       T03614                                 

Definition
(GenBank) membrane carboxypeptidase/penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cbaa  Serpentinomonas raichei
Pathway
cbaa00550  Peptidoglycan biosynthesis
cbaa01100  Metabolic pathways
cbaa01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SRAA_0268
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    SRAA_0268
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cbaa01003]
    SRAA_0268
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbaa01011]
    SRAA_0268
Enzymes [BR:cbaa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SRAA_0268
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     SRAA_0268
Glycosyltransferases [BR:cbaa01003]
 Polysaccharide
  Bacterial polysaccharide
   SRAA_0268
Peptidoglycan biosynthesis and degradation proteins [BR:cbaa01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   SRAA_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB DUF615
Motif
Other DBs
NCBI-ProteinID: BAO80122
UniProt: A0A060NGN2
LinkDB All DBs
Position
complement(283803..286217)
Genome map
AA seq 804 aa AA seqDB search
MPASSPRDPATDTSRAASAGSKPRNLARRLQSIATTAFIAAAVAALSGVLVLGVAIALAY
PKLPDVTSLSDYRPNLPLRVYARGGELIGEFGEERRNLIPYADIPPLMIHAVLAIEDERF
FEHGGVDFRGVARAALANVFDPLSQGASTITMQVARNMFLTKDRTFLRKFYEVLLTFKLE
RLLSKEEILEIYMNQIFLGHRSFGFAAAAQTYFGKSLDQLTVAEAAMLAGLPKAPSAFNP
ISNPRRARIRQLHIIDQMLANGFINAEQAQAARVEPLQLRRIDPEQFINATHVAEMVRQQ
VFAQYGQAAYERGLRVHTTIDADQQRAAVRAVRQGVINFERRQHYRGPERFIELPADAAA
REGAIDAALTAIPDDNGFFTAVVLEASARRVLLSRGEAEPIEITGTGLDSVRSGLAANAP
PHLALRPGAVVRLVRDAQQRWAITQKPVVEAAFVAMDPRNGEIRALVGGFDFERNQFNRV
VQAQRQAGSSIKPFIYSAALEHGVMASTLVNDAPLFFGAAITGGRAWEPRNYDGQFEGPM
TVRTALARSRNIPSISVLKAVGPSNAQQWLTRFGFEAEKHPPFLAMALGAGSVTPLQLAS
AYGVFANGGFYTPPQLITRITDHQGRVLMQATPQSLATAQRVIPERNAFVMTQLMGEITR
SGTAARVQSTLRRPDLYGKTGTTNDAVDVWFAGFHPTLSAVAWMGHDNPRNLGRNATGGS
LALPIWIDFMREALAGVPVQQPSAPAGLMVAGGEWYYEEFAPGQGVATLGMATEEVTTDG
SIEVAPPMAAEDRRNILDLFTRPN
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctcttcgcctcgcgaccctgcgaccgacaccagtcgggccgcttctgccggc
tccaagccacgcaacttggcgcgccgcctccagtcgatcgccaccaccgccttcatcgct
gcggcggtggccgcgctgtcgggcgttttggtgctgggcgttgccattgccttggcctac
cccaagctgcccgatgtcaccagcctgagcgactaccgccccaacctgcccttgcgcgtc
tatgccagggggggggaactgatcggggagtttggcgaggagcggcgcaacctcataccc
tacgccgatatcccgccgctgatgatccacgccgtgctggcgatcgaagacgagcgcttc
tttgagcacggtggggtggattttcgtggggtggcgcgcgccgcgctggccaacgtgttc
gacccactcagccaaggcgcctcgaccatcaccatgcaggtggcgcgcaacatgttcctg
accaaggaccgcacctttttgcgcaagttctacgaggtgctgctgacctttaagctcgag
cgcctgctgagcaaggaagagatcttggaaatctacatgaaccagattttccttgggcac
cgctcctttggctttgcggcggccgcgcaaacctacttcggcaagtccctcgaccagctc
acggtggccgaagccgccatgctggcgggcctgcccaaggcgccttcggccttcaacccg
atcagcaacccgcgccgtgcccgcattcgtcagctgcacatcatcgatcagatgttggcc
aacggctttatcaacgccgaacaggcgcaagcggcgcgcgtggagccgctgcaactgcgc
cgcatcgacccagagcagttcatcaacgccacccacgtggccgaaatggtgcgccagcag
gtttttgcccaatacgggcaggcggcctacgaacgcggcctgcgcgttcacaccaccatc
gacgccgatcagcaacgcgcagcggtgcgcgccgtgcgccaaggcgtgatcaattttgag
cggcgccagcactaccgcggccccgagcgcttcatcgaactccctgccgatgccgctgcc
cgcgaaggcgccatcgacgctgcgctcaccgccatccccgacgacaacggtttttttacc
gctgtggtgctcgaagccagcgcacgccgcgtgctgctcagccgcggcgaggcagaaccg
atcgagatcaccggcacaggcctggactcggtgcgctcggggctggctgcgaatgcaccg
ccccacctggccttgcgcccgggtgccgtggtgcggctggtgcgcgacgcccagcagcgc
tgggccatcacccaaaaacccgtggtcgaagccgcttttgtggccatggacccgcgcaac
ggggaaatccgggccttggttggcggctttgattttgagcgcaaccagttcaaccgcgtc
gtccaggcacagcgccaggccggctccagcatcaagccctttatttactcggcggcgctg
gagcacggcgtcatggcctcgaccttggtcaacgacgcgcccttgttttttggcgcagcc
atcaccgggggccgggcttgggagccgcgcaactacgacggccagttcgaaggccccatg
accgtgcgcaccgccttggcacgctcgcgcaacataccctccatcagcgtgctcaaggcg
gttggccccagcaacgcccagcagtggctgacccgctttggctttgaggccgaaaagcat
ccgccttttctggccatggcgctgggcgccggcagcgtcacaccgctgcaattggccagc
gcctacggcgtgtttgccaacggtggcttttacaccccgccgcaactcatcacgcgcatc
accgaccaccaaggccgggtgctgatgcaagcgactccgcagtcgctggccaccgcgcag
cgtgtgatccctgagcgcaatgcctttgtcatgacccaactgatgggcgaaatcacccgc
agcggcacggcggcacgggtgcaatccaccctgcgccgccccgacctctacggcaaaacc
ggcaccaccaacgacgcggttgacgtttggtttgctggctttcaccccaccttgtcggcg
gtggcttggatggggcacgacaacccgcgcaacctgggccgcaacgccaccggcggatcg
ctggcgctgccgatttggatcgacttcatgcgtgaggcactggccggcgtaccggtgcaa
cagcccagcgctcctgctgggttgatggtggctgggggggagtggtactacgaggaattt
gccccggggcaaggcgtggccacgctgggcatggccaccgaagaagtcaccacagacgga
tccattgaagtggccccgcccatggctgccgaggaccgacgcaacatcctagacctgttt
acgcgcccgaactaa

DBGET integrated database retrieval system