KEGG   Serpentinomonas raichei: SRAA_0274Help
Entry
SRAA_0274         CDS       T03614                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
cbaa  Serpentinomonas raichei
Pathway
cbaa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cbaa01100  Metabolic pathways
cbaa01110  Biosynthesis of secondary metabolites
cbaa01130  Biosynthesis of antibiotics
cbaa01230  Biosynthesis of amino acids
Module
cbaa_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SRAA_0274 (aroK)
Enzymes [BR:cbaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SRAA_0274 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 AAA_17 Cytidylate_kin2 AAA_22 Cytidylate_kin AAA_16 AAA_5 AAA KTI12 Thymidylate_kin 6PF2K Viral_helicase1 CoaE AAA_28 ABC_tran Ploopntkinase3 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: BAO80128
UniProt: A0A060NKW0
LinkDB All DBs
Position
291548..292093
Genome map
AA seq 181 aa AA seqDB search
MIILIGLPGSGKSTVGRLLARRLQLPFVDSDSAIEQRLGCSIREFFEREGEARFRDEEQA
LIDELTQAAPCVLSTGGGAVLRPANRQCLRERGRVFYLRSSPEEVFRRVQHDRSRPLLQV
ADPLQKLRELYAQRDPLYRETAHHVVETGRPSVASLVNWIAAQLELQRAAPKPIHTSEAS
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgatcatcctcatcggcctgcccggatcgggcaaatccacggttgggcgcttgctggcg
cggcggctgcaactgccttttgtggattccgacagcgccatcgagcagcgcttgggttgc
agcatccgcgagtttttcgagcgcgagggcgaggcccgctttagggacgaggagcaggcg
ctgatcgatgagctgacgcaggccgccccttgcgtgctgtccaccggtgggggtgcggtg
ctgcggccggccaaccggcagtgcctgcgcgagcgcggccgcgtcttttatttgcgctcc
agccccgaagaggtgtttcgccgggtgcagcacgaccgcagccggccgctgctgcaagtg
gccgacccactgcaaaaattgcgcgagttgtacgcccaacgcgacccgctctaccgcgag
accgcgcaccatgtggtcgagaccggccggccctcggtggcgtcgctggtcaactggatt
gccgcccaactggagctgcaacgcgccgcccccaagcccatacacacatccgaggcttcg
ctgtga

DBGET integrated database retrieval system