KEGG   Serpentinomonas raichei: SRAA_1238Help
Entry
SRAA_1238         CDS       T03614                                 

Gene name
ahpF-1
Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbaa  Serpentinomonas raichei
Brite
KEGG Orthology (KO) [BR:cbaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SRAA_1238 (ahpF-1)
Enzymes [BR:cbaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SRAA_1238 (ahpF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAO81092
UniProt: A0A060NIE6
LinkDB All DBs
Position
complement(1327884..1329479)
Genome map
AA seq 531 aa AA seqDB search
MLDDTLKAQLQAYLERLQQPIELVAALDGSSASLEMRELLETIAALSNKIALRTDGQDAR
VPSFTVQGQGQPGQLRFAAVPLGHEFTSLVLALLWAGGHPPKVEAGLIEQIKALPGDYRF
EIYMSLSCHNCPDVVQALSLLALLNPRVQTVVIDGALFQQEVNERDVLAVPSVYLNGAAF
GSGRMSVEEVLAKLDAGALVKQAQQLDALEPFDVLNIGGGPAGAAAAVYAARKGIRTGLL
AERMGGQLNDTLAIENYPSQLHTEGPKLAAALEAHVRHYEVQIMNLQRAVRLLPAAQPGG
LIGIELASGAVLKARSVVLSTGARWRNMNVPGEREYQNKGVAYCPHCDGPLFKGKRTAVI
GGGNSGVEAAIDLAGIVQHVTLLEFAAELRADAVLQAKLRSLPNVTVITQAQTTEVLGDG
ARVNGLRYTNRATGSAHDLALEGIFVQIGLVPNTEWLKGALALSPHGEIVIDARGHTSVP
GVFAAGDCTTVPYKQIVIAAGEGAKAALSAFDYLIRTPQPQQVVGEAVPQV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgataccctcaaagcccagctccaagcctatttggagcgcctgcagcagccg
atcgagctggtggccgcgctggatggctccagcgcctcgctagagatgcgcgagttgctc
gaaaccatcgctgcgctctcaaacaaaatcgcgttgcgcaccgacgggcaagacgcgcgc
gtgccatcctttaccgtgcaagggcagggccagccgggccagttgcgttttgccgccgtg
ccgctgggccacgagttcacctcgctggtgctggcgctgctgtgggcgggcgggcatccg
cccaaggtcgaagccggcctgatcgagcagatcaaggccttgccgggcgactaccgattt
gagatttatatgtcgctgagctgccacaactgccccgatgtggtgcaggcgctcagcctg
ctggcgctgctgaatccgcgcgtgcagacggtggtgatcgacggcgcgctgttccagcaa
gaggtgaacgagcgcgatgtgctggcggtgccgtcggtgtatctgaatggggccgcgttt
ggctcgggccgcatgagcgtggaagaggtgctggccaagctcgacgccggtgctctggtc
aagcaggcgcagcagctcgatgcgctggagcccttcgatgtgctcaacatcggcggtgga
ccggccggtgcggcggcggcggtgtatgcggcgcgcaagggcatccgcaccggcttgctg
gccgagcgcatgggtggccagctcaacgacacgctggcgatcgaaaactacccctcgcaa
ctgcacaccgaaggccccaagctggccgccgcgctggaggcgcacgtgcgccactacgag
gtgcagatcatgaacctgcagcgtgcggtgcggctgctgcctgcggcacagccgggtggc
ctgatcggcatcgaactggccagtggcgcggtgctgaaagcgcgcagcgtggtgctgagc
accggagcgcgctggcgcaacatgaacgtgccgggcgagcgcgaataccaaaacaaaggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcacggcggtgatc
ggcggcggcaactcgggcgtggaagccgcgatcgacctggccggcatcgtgcagcacgtg
acgctgctcgaatttgccgccgaactgcgcgccgacgcggtgctgcaagccaagctgcgc
agcctgcccaacgtaaccgtgatcactcaggcgcagaccaccgaggtgctgggtgacggc
gcacgcgtcaacggtctgcgctacaccaaccgcgccaccggcagcgcgcacgatctggcg
ctggaaggcatttttgtgcagatcggcctggtgcccaataccgaatggctcaagggtgcg
ctggccctgagcccccacggcgagatcgtgatcgacgctaggggccacaccagcgtaccc
ggcgtgtttgccgcgggcgactgcaccaccgtgccctacaagcagatcgtgattgcggcc
ggcgaaggggccaaagcggcgctgagcgcttttgattacctgatccgcaccccgcagccg
caacaggtggtgggggaggcggtgccgcaagtctga

DBGET integrated database retrieval system