KEGG   Comamonadaceae bacterium B1: SMCB_0034Help
Entry
SMCB_0034         CDS       T03627                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00564  Glycerophospholipid metabolism
cbab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SMCB_0034
Enzymes [BR:cbab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     SMCB_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox_2 FAD_binding_3 Thi4 GIDA Pyr_redox_3 Lycopene_cycl Pyr_redox
Motif
Other DBs
NCBI-ProteinID: BAO82262
UniProt: A0A060NKM0
LinkDB All DBs
Position
38627..40252
Genome map
AA seq 541 aa AA seqDB search
MNRQQSLEHLQRVPVWDLLVVGGGATGLGVALEAAQRGWRVALLESHDFASGTSSRSTKL
LHGGVRYLAQGNLALVREALAERQAVLKIAPHLAQPLPFVMPCYQPWQAPFYGVGLKLYD
WLAGRAGLGPTRWLGREQTQAALPGVQALGLRGGIQYWDAQFEDARLALAVARSAEVAGA
LLLNCVQVQGIEAGADVQGGRVLRVQALDRHGGQRLQLQARCVVNATGVWVDQLRQGVQP
EAPPLVQPSQGVHLVVARDFLPGQQALLVPRTADGRVLFAVPWLGALVLGSTDTPRTDLP
REPEPFEAEIEFILREASQALARPVRRADVRSVWVGLRPLVAAPAAGGSTQALSREHRIV
VDPAGLVTVTGGKWTTYRAMASEVLAHGVAAGLLAPRPALDHPLTPLFGAGEANAQAHAD
ANEAAGANAALTHPALHQAPGLHLYGDQAAAVQALPGAERALGMGLTEAMVRYAVRHEWA
LTVEDVLARRWRALFLDATAAEGMAAAVAAIVQDELQRAGAPHTDPGLQAFVALAQRYRL
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccagcagtctctagagcatttgcagcgcgtcccggtgtgggatctgctggtc
gtcggcggcggtgccaccggtttgggggtggcgctggaggcggcgcagcgcggctggcgg
gtggcgctgctggagtcgcacgacttcgccagcggcacctcgtcgcgttccaccaagctg
ctgcacggcggggtgcgctacttggcgcagggtaatctggccttggtgcgcgaggcgctg
gccgaacgccaagcggtgctcaagattgccccgcatctggcgcagccgctgcctttcgtg
atgccctgctaccagccttggcaagcgcctttttatggggtcgggctcaagctctacgat
tggttggccggccgcgcgggcctagggcccacccggtggctggggcgcgagcagacccaa
gccgcgctgccgggggtgcaggcgctggggttgcgcggcggcatccagtactgggacgcc
cagttcgaggacgcgcggctggcgctggctgtggcgcgcagcgccgaggtggctggggcg
ctgttgctcaattgcgtgcaggtgcagggcattgaagcgggcgccgatgttcagggtggc
cgcgtgctgcgggtgcaggcgctcgaccgccacgggggccagcggttgcagttgcaggcg
cgttgcgtcgtcaacgccaccggggtctgggtggaccagctgcgccagggcgtgcaaccc
gaagcgccgccgctggtgcagcccagtcaaggggtgcatctggtggtggcgcgcgatttt
ctgcccgggcagcaggccctgctggtgccgcgcaccgccgatggccgggtgctgtttgcg
gtgccgtggctgggggcgctggtgttgggcagcaccgacacgccgcgcaccgacctgccg
cgcgaacccgagccgttcgaggccgaaatcgagttcatcttgcgcgaggcgtcgcaggcg
ctggcgcggccggtgcgccgcgccgacgtgcgcagcgtctgggtgggcttgcggccgctg
gtggcggcgcccgcagcaggggggagcacccaagcgttgtcgcgcgagcaccgcatcgtg
gtcgatcccgctgggctggtgacggtcacggggggcaagtggaccacctaccgcgccatg
gccagcgaggtgctggcgcacggggtggcggccgggttgttggcgccgcgcccggccttg
gaccatccattgacccctttatttggggctggcgaagcaaacgcgcaagcccatgcggat
gcgaatgaggccgcaggagcaaatgccgcacttacgcacccagcgctgcaccaggcgccg
ggcttgcacctctacggcgaccaagcagcggcggtgcaggccctgcccggtgccgagcga
gcgctgggcatgggcctgaccgaggccatggtgcgctacgccgtgcgccacgagtgggcg
ctgacggtcgaagacgtgttggcgcggcgctggcgcgcgctgttcctcgatgccaccgcc
gccgaaggcatggctgcggcagtggccgctatcgtgcaagacgagttgcagcgcgccggc
gcaccgcacaccgaccccggcttgcaggcctttgtggcgctcgcgcaacgctaccggctc
aactaa

DBGET integrated database retrieval system