KEGG   Comamonadaceae bacterium B1: SMCB_0777Help
Entry
SMCB_0777         CDS       T03627                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase and related aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00250  Alanine, aspartate and glutamate metabolism
cbab00280  Valine, leucine and isoleucine degradation
cbab00410  beta-Alanine metabolism
cbab00640  Propanoate metabolism
cbab00650  Butanoate metabolism
cbab01100  Metabolic pathways
cbab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SMCB_0777
   00650 Butanoate metabolism
    SMCB_0777
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SMCB_0777
   00280 Valine, leucine and isoleucine degradation
    SMCB_0777
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SMCB_0777
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cbab01007]
    SMCB_0777
Enzymes [BR:cbab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SMCB_0777
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SMCB_0777
Amino acid related enzymes [BR:cbab01007]
 Aminotransferase (transaminase)
  Class III
   SMCB_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: BAO83005
UniProt: A0A060NNR1
LinkDB All DBs
Position
complement(806483..807865)
Genome map
AA seq 460 aa AA seqDB search
MNTPSSTAPATPTTPATNAALMARRRAALPAGLGQTYEVFVERADNAEVWDVQGQRYIDF
AGGIAVLNTGHRHPRIVQAVKAQLDQYHHTCFQVLAYEPYVELAERLIALAPGDFAKKAF
FLSTGAEAVENAVKIARAATKRSAVIAFGGGFHGRTLLGMALTGKVAPYKSGFGPFPAEI
YHAEFPNPLHGVSVADALRSLDHLFKYDLEPARVAAIILEPVQGEGGFYVAPPEFAQALR
ALCDQHGIVLIADEIQTGAGRTGTWLACEQWGPQACPDLITMAKSMAGGFPLSAVIGRAD
LMDAPAPGGLGGTYAGHPLACAAALAVLDVFEQEQLLPRAQAVGARLRAGLQALAALHPE
IGDVRGLGAMLAIELFAPEPAAHSAAHPASHPSQRQPDPELTRRVCAEALARGLVLLSCG
LYANVIRILVPLTASDALLDEGLALLGAALAAAKGAAKPE
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccccgtccagcaccgcacccgccacccccaccaccccagccaccaacgccgcg
ctgatggcgcgccgccgcgccgccctgcccgctgggctgggccagacctacgaggtgttc
gtcgagcgcgccgacaacgccgaagtctgggacgtgcaaggccagcgctacatcgacttt
gcgggcggcatcgccgtgctcaacaccgggcaccggcacccgcgcatcgtgcaggcggtc
aaggcgcagctcgaccagtaccaccacacctgctttcaggtgctggcctacgagccctac
gtggaactggccgagcgcctgattgccctcgcgccgggagactttgccaaaaaagccttt
ttcctttccaccggggccgaggcggttgaaaacgcggtcaagatcgcgcgcgccgccacc
aagcgctcggcggtgatcgcctttggcggcggctttcatggccgcaccctgctcgggatg
gcgctcaccggcaaggtggcgccctacaaaagcggctttgggccttttccggccgagatt
taccacgccgaattccccaacccgctgcacggcgtgagcgtggccgacgcgctgcgctcg
ctcgaccacctgttcaagtacgacctcgagcccgcgcgcgtggccgccatcatcctcgag
ccggtgcagggcgaaggcggcttttacgtggccccacccgagtttgcccaagccctgcgc
gcgctgtgcgaccagcacggcatcgtgctcatcgccgacgaaatccagaccggcgccggc
cgcaccggcacctggctggcgtgcgagcagtgggggccgcaggcctgccccgacctgatc
accatggccaagtcgatggctggcggctttccgctgtcggccgtgatcggccgcgccgac
ctgatggacgcccccgcccccggcggcttgggcggcacctacgccgggcacccgctggcc
tgcgcggccgcgctggcggtgctcgatgtgttcgagcaagagcagctgttgccgcgcgcg
caagccgtgggagcgcggctgcgcgccggcttgcaggcgctggcagcgctgcaccccgaa
atcggcgatgtgcgcggcctaggggccatgctggcgatcgagctgtttgcgcccgagccc
gctgcacattccgccgcacaccccgcctcccaccccagccagcgccagcccgaccccgaa
ctcacacgccgcgtctgtgccgaagcgctggcgcgcgggctggtgctgctctcgtgtggc
ctgtacgccaacgtgatccgcatcttggtgccgctcaccgcctccgatgccctgctcgac
gaagggctggcgctgctgggtgcggcgctggcggcggccaagggcgcagcaaagcccgaa
taa

DBGET integrated database retrieval system