KEGG   Serpentinomonas mccroryi: SMCB_1000Help
Entry
SMCB_1000         CDS       T03627                                 

Gene name
ahpF-2
Definition
(GenBank) alkyl hydroperoxide reductase, large subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbab  Serpentinomonas mccroryi
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SMCB_1000 (ahpF-2)
Enzymes [BR:cbab01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SMCB_1000 (ahpF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin NAD_binding_8 Thi4 K_oxygenase FAD_binding_3 FMO-like
Motif
Other DBs
NCBI-ProteinID: BAO83228
UniProt: A0A060NUK6
LinkDB All DBs
Position
complement(1063706..1065301)
Genome map
AA seq 531 aa AA seqDB search
MLDAALKAQLQAYLERLQQPVDLVAALDDSSAAQEMRELLETLAAMSDKIRLRTDGQDAR
VPSFSVQGQGGPGGLRFAAVPLGHEFTSLVLALLWAGGHPPKVEAGLIEQIKALPGDYRF
EVYMSLSCHNCPDVVQALSLMALFNPRVQTVVIDGALFQQEVNERDVLAVPSVYLNGAVF
GSGRMSAEEVLAKLDAGSLVKQAQQLDALEPFDLLNIGGGPAGMAAAVYAARKGIRTGLL
AERMGGQLNDTLGIENYPAQLHTEGPKLAAELEAHARHYEVQLMNLQRAVRLLPAAQPGG
LIGVELASGAVLKARSVVLSTGARWRNMNVPGETEYKNRGVAYCPHCDGPLFKGKRTAVI
GGGNSGVEAAIDLAGIVQHVTLLEFADELRADAVLQAKLRSLPNVSVITQAQTTEVLGDG
ARVVGLRYTDRRSGTPQELALEGIFVQIGLVPNTEWLKGTLELNRFGEIAIDAKGHTSLP
GVFAAGDCTTVPYKQIVIAAGEGAKAALSAFDYLIRTPQAQTAPIEAVPQV
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccgccctcaaagcccagctccaagcctatctggagcgcctgcagcagccg
gttgatctggtggctgcgctcgacgattccagcgccgcgcaagagatgcgtgagctgctc
gaaaccctggctgccatgtcggacaaaatccggctgcgcaccgacgggcaagacgcgcgc
gtgccgtcttttagtgtgcaagggcagggcgggccgggcggcttgcgttttgccgccgtg
ccgctgggccacgagttcacctcgctggtgctggcgctgctgtgggcgggtgggcatccg
cccaaggtcgaggcgggcctgatcgagcagatcaaggccttgccgggcgactatcgtttc
gaggtctatatgtcgctgagctgccacaactgccccgacgtggtgcaggcgctcagcctg
atggcgctgttcaacccccgcgtgcagacggtggtgatcgacggcgcgctgttccagcaa
gaggtcaacgagcgcgacgtgctcgcggtgccttcggtgtatttgaacggcgcggtgttc
ggctcgggccgcatgagcgccgaagaggtgctggccaagctcgacgctggctccctcgtc
aaacaagcgcagcagctcgatgccttggagccgtttgacctgctcaacatcggcggtggc
ccagctggcatggcggcggcggtgtacgcagcgcgcaaaggcatccgcaccggcttgctg
gccgagcgcatgggcggccagctcaacgacacgctgggcatcgagaactaccccgcgcag
ctgcacaccgaaggccccaagctggccgccgagctggaggcgcatgcgcgccactacgag
gtgcagctcatgaacctgcaacgcgccgtgcgcctgctgccggcggcgcagcccggcggc
ttgatcggcgtcgagctggccagcggtgcggtgctcaaggcgcgcagcgtggtgctctcc
accggggcgcgctggcgcaacatgaacgtgccgggcgagaccgaatacaaaaaccgcggc
gtggcctactgcccacactgcgacggcccgctgttcaagggcaagcgcacggcggtgatc
ggcggcggcaactcgggcgtggaagcggcgatcgacctggccggcatcgtgcagcacgtg
acgctgctcgagtttgccgacgagctgcgcgccgatgcggtgctgcaagccaagctgcgc
agcctgcccaacgtgagcgtgatcacgcaagcgcaaaccaccgaggtgctgggcgacggc
gcgcgcgtggtgggcctgcgctacaccgaccgccgcagcggcacgccgcaagaattggcg
ctggaaggcatttttgtgcagatcggcttggtgcccaacaccgaatggctcaagggcacg
ctggagctcaaccgctttggcgagatcgccatcgacgccaagggccacaccagcctgccg
ggcgtgtttgccgccggcgactgcaccacggtgccctacaagcagatcgtgatcgccgcc
ggcgagggcgccaaagcggccctgagcgccttcgattacctgatccgcaccccgcaggca
caaacggcgcccatcgaggccgtgccgcaggtttga

DBGET integrated database retrieval system