KEGG   Comamonadaceae bacterium B1: SMCB_2155Help
Entry
SMCB_2155         CDS       T03627                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00473  D-Alanine metabolism
cbab01100  Metabolic pathways
cbab01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbab00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SMCB_2155
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SMCB_2155
Enzymes [BR:cbab01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SMCB_2155
Peptidoglycan biosynthesis and degradation proteins [BR:cbab01011]
 Precursor biosynthesis
  Racemase
   SMCB_2155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: BAO84383
UniProt: A0A060NXZ6
LinkDB All DBs
Position
2327348..2328514
Genome map
AA seq 388 aa AA seqDB search
MPRPILATIHLPALQHNLQRCRRAGGSARVWAVLKANAYGHGIERVFDALRAADGLALLD
LGEAERLRALGWRGPILLLEGAFEPRDLETCSRLQLWHVVHRSEQIDWLAAHKCETPQRV
FLKMNSGMNRLGLRPEAFRAAYTRLSHLPQVEEISLMTHFSDADGQRAGQMGVQHQLEAF
VRASHDLPGERSLCNSAALLRHGLALRLGSGPEAQPLAADWTRPGIALYGSSPDFPTHSA
AHWALEPAMTLASQLIAVQELAAGETVGYGSTYTAPGAMRIGIVACGYADGYPRHAPGHN
AHGGPVLVRGVRTRLVGRVSMDMLAVDLGPVEAQLGPCHAGDEVTLWGRSRCGALLPIDE
VAHAAGTLGYELMCALAARVPVAVEPLP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgccccatcctcgccaccatccacctgcctgcgctgcagcacaacctacaacgc
tgccgccgcgccggtggctcggcccgggtgtgggcggtgctcaaggccaacgcctacggc
cacggcatcgagcgcgtgtttgacgcgctgcgcgccgccgacggcttggcgctgctggac
ctgggcgaggccgagcggctgcgcgccctcggctggcgcggccccattttgttgctcgag
ggcgcctttgagccccgcgacctcgaaacctgctcgcggctgcagctgtggcacgtggtg
caccgcagcgagcagatcgactggctggcggcgcacaagtgcgaaacaccgcagcgcgtg
ttcctaaaaatgaactcgggcatgaaccggctcggcctgcgccccgaggcctttcgcgcc
gcctacacgcgcctgagccacctgccccaggtcgaagaaatcagtctgatgacgcacttc
agcgacgccgacggccagcgcgccggccagatgggcgtgcagcaccagctcgaggccttt
gtgcgcgccagccacgacctgcccggcgagcgcagcctgtgcaacagcgccgccctgctg
cgccacgggctggcactgcggctgggcagcggccccgaggcacagccgctggccgccgac
tggacccggcccggcatcgcgctctatggcagctcgcccgacttccccacccacagcgcc
gcgcactgggcgcttgaacccgccatgacgctggccagccagctgatcgcggtgcaagag
ctggccgccggcgaaaccgtcggctacggctccacctacaccgcccccggcgccatgcgc
atcggcatcgtggcctgcggctacgccgacggctacccgcgccatgcgcccggccacaac
gcccacggcggcccggtgctggtgcgcggcgtgcgcacgcgcttggtcgggcgcgtgagc
atggacatgctggcggtcgatctgggcccggtcgaggcgcagctgggaccgtgccacgcg
ggcgatgaagtcacgctctggggccgcagccgctgcggcgcgctgctgccgatcgacgag
gtggcgcacgccgccggcaccttgggctacgagctgatgtgcgcgctggccgcgcgggta
ccggtcgcggtcgagccgctgccttaa

DBGET integrated database retrieval system