KEGG   Serpentinomonas mccroryi: SMCB_2332Help
Entry
SMCB_2332         CDS       T03627                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cbab  Serpentinomonas mccroryi
Pathway
cbab00630  Glyoxylate and dicarboxylate metabolism
cbab01100  Metabolic pathways
cbab01120  Microbial metabolism in diverse environments
cbab01200  Carbon metabolism
Module
cbab_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cbab_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cbab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMCB_2332
Enzymes [BR:cbab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SMCB_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small IclR
Motif
Other DBs
NCBI-ProteinID: BAO84560
UniProt: A0A060NT82
LinkDB All DBs
Position
complement(2535645..2535971)
Genome map
AA seq 108 aa AA seqDB search
MAVQAYQQTQRYETFSYLPPMKPEQVRRQIAYAIAQGWNPAVEHTERGTAATSSFWYMWK
LPLFGEQSVDAVLTEVEACHREFPNHVVRFVAYDNYSQSQGLAFVVYR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggccgtacaagcctaccaacaaacccagcgctacgagaccttttcctacctgccgccg
atgaagcccgagcaggtgcggcgccagatcgcctacgcgattgcccaaggctggaaccca
gcggtcgagcacaccgagcgcggcaccgccgccaccagcagcttttggtacatgtggaag
ctgccgctgtttggcgaacaaagcgtggatgcggtgttgaccgaggtcgaagcctgccac
cgcgagttcccaaaccacgtggtgcgcttcgtggcctacgacaactactcgcaaagccag
ggtctggccttcgtggtctatcgctga

DBGET integrated database retrieval system