KEGG   Comamonadaceae bacterium B1: SMCB_2333Help
Entry
SMCB_2333         CDS       T03627                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cbab  Comamonadaceae bacterium B1
Pathway
cbab00630  Glyoxylate and dicarboxylate metabolism
cbab01100  Metabolic pathways
cbab01120  Microbial metabolism in diverse environments
cbab01200  Carbon metabolism
Module
cbab_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cbab_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cbab00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SMCB_2333
Enzymes [BR:cbab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     SMCB_2333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAO84561
UniProt: A0A060NPQ2
LinkDB All DBs
Position
complement(2536025..2537446)
Genome map
AA seq 473 aa AA seqDB search
MAVKSYSAGVKEYRQTYWMPDYIPLDTDLLAVFKITAQAGVDREEAAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDSCFYAFIAYPIDLFEEGSVVNVFTSLVGNVFGF
KAVRALRLEDVRFPIAYVKTCGGPPHGIQVERDILNKYGRPMLGCTIKPKLGLSGKNYGR
AVYECLRGGLDFTKDDENINSQPFMRWRQRFDFVQEATLKAEAETGERKGHYLNVTAPTP
EEMYKRAEYAKEIGAPIIMHDYITAGFCANTGLANWCRENGMLLHIHRAMHAVIDRNPHH
GIHFRVLTKILRLSGGDHLHTGTVVGKLEGDREATLGWIDLLRESFVPENRARGIFFDQD
WGSMPGLFAVASGGIHVWHMPALVSIFGDDSVLQFGGGTLGHPWGNAAGAHANRVALEAC
VQARNEGRQLEKEGKEILSAAAAHSPELKIAMETWKEIKFEFDTVDKLDVTHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagtcttacagtgccggtgtcaaagaataccgtcaaacctattggatgccc
gattacatccccctcgacaccgacttgttggcggtgttcaagattaccgcacaggcgggg
gtggatcgcgaagaggccgcagccgcggtggcagccgaatcgtccaccggcacctggacc
acggtctggaccgacttgctcaccgacctcgactactacaagggccgcgcctaccgcatc
gaagacgtgcccggcgacgacagctgcttctacgccttcatcgcctacccgatcgacctg
ttcgaagagggctcggtggtcaacgtcttcacctcgctggtgggcaacgtgttcggcttc
aaggccgtgcgtgcgctgcgcctcgaagacgtgcgcttcccgatcgcctacgtgaaaacc
tgtggcggcccaccgcacggcattcaggtcgagcgcgacattctgaacaagtacgggcgc
ccgatgctgggctgcaccatcaagcccaaactcggcttgagcggcaagaactacggccgc
gccgtttacgaatgcttgcgcggcgggctcgatttcaccaaagacgacgaaaacatcaac
agccaaccgttcatgcgctggcgccagcgctttgactttgtgcaagaagccacgctcaag
gccgaggccgagaccggcgagcgcaagggccactacctcaacgtcaccgccccgacgccc
gaggaaatgtacaagcgcgccgagtacgccaaagagatcggcgcgccgatcatcatgcac
gactacatcacggccggtttttgcgccaacaccggcttggccaactggtgccgcgaaaac
ggcatgctgttgcacatccaccgcgccatgcacgccgtgatcgaccgcaacccgcaccac
ggcatccacttccgtgtgctgaccaagattttgcgcctctcgggcggcgaccacctgcac
accggcaccgtggtcggcaagctcgagggcgaccgcgaggccacgctgggctggatcgat
ctgctgcgcgaatcgttcgtgcccgaaaaccgcgcccgcggcatcttctttgaccaagat
tggggctcgatgcccggtctgttcgcagtcgcctcgggcggcatccacgtctggcacatg
ccggcgctggtgagcatctttggcgacgattcggtgctgcaattcggtggcggcacgctc
ggccacccctggggcaacgccgccggcgcacacgccaaccgggtggcgctcgaagcctgc
gtgcaagcgcgcaacgaaggccggcaactggaaaaagagggcaaagaaatcctcagcgcc
gccgccgcccacagcccggaactcaagatcgcgatggaaacctggaaagagatcaagttc
gagttcgacaccgtcgacaagctcgacgtgacccacaagtga

DBGET integrated database retrieval system