KEGG   Chitinophaga caeni: COR50_07470Help
Entry
COR50_07470       CDS       T05360                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cbae  Chitinophaga caeni
Pathway
cbae00473  D-Alanine metabolism
cbae01100  Metabolic pathways
cbae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    COR50_07470
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    COR50_07470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbae01011]
    COR50_07470
Enzymes [BR:cbae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     COR50_07470
Peptidoglycan biosynthesis and degradation proteins [BR:cbae01011]
 Precursor biosynthesis
  Racemase
   COR50_07470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ATL49764
UniProt: A0A291R0Y7
LinkDB All DBs
Position
complement(1778396..1780897)
Genome map
AA seq 833 aa AA seqDB search
MYNADSTSKFLKGELLQQTGNPEFEHILLDSRKLNFAETSVFIPLVSNRRNAHQFIDEVY
QKGVSNFIVSETPDLSKYPEANFILVKDTMQALHALVAHHRQQFQIPVIGITGSNGKTIV
KEWLYQLLEKDYNIVRSPKSYNSQIGVPLSVWQMKPENDLAIFEAGISQPGEMVNLEKII
RPTIGVFTNIGEAHNEGFLNIRQKINEKLVLFMKSDVLIYCKDYLVLNECVNTFHNQVGK
KEGDNSMQILSWSRKTEADIRIINIDKEENSTRIDAMFKEEPMHITIPFVDEGSIENAIH
CWVVMLYLGKSQEVIQERMLGLGNIAMRLELKQGINNCSVINDSYNSDLGSLTIALDFLQ
QQRQHLLKTVILSDILQSGKSEASLYEEVADLLDKKGIQKLVGIGKGIGREKRVFQQLPN
LKSAFYNSTEEFLQEFNPQEYNNETILVKGARVFEFERIIKLLEQKAHQTILEINLGAIS
HNVQQYQAILKPGTKLMGMVKAFSYGSGSYEIASQLQFMGVDYLTVAYADEGVELRRAGI
TLPIMVMNPEPSSFDAILQWNLEPEIYSLHVFQLFEEEVRIAGKTQYPIHLKLDTGMHRL
GFEKKDIPRLIKLLMEQDYFHVKSIFSHLAASEDPFMDAFTKKQGELFTEMSGEIRKALC
YPVLRHIANSAAISRHPDLQFDMVRLGIGMYGIDGNPEMQEKLQNVSTLKTTIAQVKKIP
AGEPVGYGAKWKSKKPATIATVRIGYADGYPRNLGNGKGKMMLHGQLVPVAGVIAMDMLM
LDVSAVPNVQEGDEVLVFGAALPLQQLATWGDTIPYEIMTGISQRVKRVYFQE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
gtgtataacgcagacagtaccagtaaattccttaagggagaattactacaacaaaccggg
aacccggaattcgagcatattttattggacagccgtaaactcaatttcgcggaaacttcc
gtatttattccattggtgagcaacaggagaaacgcacatcaatttatcgacgaagtgtat
caaaaaggagtcagcaatttcatcgtcagcgaaactccggacttgtcaaagtatcccgag
gctaatttcatattagtaaaagatacaatgcaggcattgcatgcactcgtggcgcatcac
cgccaacaattccaaatacctgtaatcggcatcaccggaagcaacggtaaaaccatcgta
aaagaatggctctaccaattgttggaaaaagattataatatcgttcgtagcccgaagagc
tataactcgcaaataggcgttcccttatctgtttggcagatgaaaccggaaaatgatctc
gcgatcttcgaagccggcatctcccaaccgggcgagatggtgaacctggaaaagatcatc
cggccaactatcggggtatttaccaatatcggggaagcacataacgaaggcttcctgaac
atccgccagaaaatcaatgagaaactggtgctgttcatgaaaagcgatgtgctgatatat
tgcaaggattacctggtattgaatgaatgtgtcaacactttccacaaccaagttggtaaa
aaagaaggtgacaacagtatgcagatattgagctggtcaagaaaaaccgaggccgatatc
cgcattattaatattgacaaagaagagaatagtacccgcatcgatgccatgttcaaagaa
gaaccgatgcatatcacgatcccgttcgtggatgaaggttctatcgagaacgctatccat
tgttgggtagtgatgttgtacctgggtaaatcgcaagaagtgatacaggaacgcatgctc
ggcctgggaaatatcgcgatgcgactggagctgaaacaaggtatcaataactgctccgtt
atcaacgatagctataattccgacctcggctcattaaccattgccctcgactttttacaa
cagcaaaggcagcacctgctgaaaacagtgatcttgagcgatatcttgcaaagcggtaag
agtgaagccagtttgtatgaagaagtggccgacctgctcgataaaaagggtattcagaaa
ttagtcggcataggtaaaggtatcggcagggaaaaaagggtattccagcaattgcccaac
ctcaaaagcgcattttataatagtacggaagaatttctacaggaatttaatccgcaagaa
tataataatgaaaccatactggtaaagggcgcccgggtatttgaatttgaaagaatcatc
aagttactcgaacagaaagcgcatcaaaccatcttggaaatcaacctgggagccatttct
cacaatgttcagcaataccaggccatcctgaaacccggcaccaagctgatgggtatggtg
aaggccttctcctatggcagcggtagttacgaaatcgcgagccaattgcagttcatgggc
gtagactacctcaccgtggcttatgccgatgaaggcgtagaactccgccgcgcgggaatt
accttacctatcatggtcatgaatcccgaacccagttcattcgatgccatcttgcaatgg
aacttggaaccggagatctattcattacatgtattccagttattcgaagaagaagtacgc
atagcggggaaaacgcaatatcctatccatttgaagctcgataccggtatgcaccgttta
ggtttcgaaaagaaagatattccgcggttgattaagttattgatggagcaagattatttc
catgtgaagtccatattcagtcaccttgcagccagcgaagatcctttcatggatgctttt
actaaaaagcaaggtgaattatttacagagatgagcggggagatcaggaaagcattgtgc
tacccggtattgcggcatattgccaatagcgccgcgatcagccgccatcccgacttgcaa
tttgatatggtccggttgggaatcggtatgtacggcatcgatggcaacccggagatgcaa
gaaaagttgcagaacgtgagtacactgaagaccaccatagcacaagtcaaaaaaattcct
gccggcgaacctgttggatatggagctaagtggaaatctaaaaaaccggctaccatcgcc
acggtgagaattggttatgctgatggatacccgcgcaaccttggcaatggcaaagggaag
atgatgttacatggtcaattagtgcctgtagccggggtaatagccatggatatgttgatg
ctggatgtgagcgcagtacccaatgtgcaggaaggtgatgaggtgctcgtgtttggagcc
gcgttgccattgcagcaacttgccacctggggagatacgataccgtacgagattatgaca
ggcatctcgcaaagggtgaaaagagtatattttcaagaataa

DBGET integrated database retrieval system