KEGG   Chitinophaga caeni: COR50_08285Help
Entry
COR50_08285       CDS       T05360                                 

Definition
(GenBank) acyl-CoA desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
cbae  Chitinophaga caeni
Pathway
cbae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    COR50_08285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbae01004]
    COR50_08285
Enzymes [BR:cbae01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     COR50_08285
Lipid biosynthesis proteins [BR:cbae01004]
 Desaturase
  Front-end
   COR50_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: ATL47182
UniProt: A0A291QTH6
LinkDB All DBs
Position
1968771..1969853
Genome map
AA seq 360 aa AA seqDB search
MPKVSFNNKNATFFKSLKKEVDLYFSNKNIRQSGDRRLHSKTIILILTALGIYISLLFWQ
DIPVILGISMCGILGFTLAAIGFNVMHDACHGSYSSKNWVNQTLGLTLNTLGGNSFIWKQ
KHNIVHHTYTNVDGVDDDIAKSPFIRHCSTQKWNPMHRYQHLYIIFLYAISSFAWVFFFD
FEKYLKKRVHTTQLQKMQFSDHLVFWFSKVMYLVFYVGLPVLLLGWKPWLIGFVAMHLVM
GFTLAIVFQLAHVVEETSFEFVHEDDKVIENEWAIHQVNTTSNFAPGNAIISWWAGGLNY
QVEHHLFPRISHVHYPELSKIVRMKCEEFGVKYNSMPTMFEAVRSHFRFIKELGQRPAGI
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagtttcatttaataataagaatgccacgttttttaaatcgttaaagaaggaa
gtagacctatattttagcaataaaaatattcgtcaatccggtgatcggcgtttgcatagt
aaaacgatcatccttattttaactgcgctgggaatatacatttcattattattttggcag
gatataccggtaatattagggatttcgatgtgcggcatactggggttcaccctggcggct
atcggcttcaatgtaatgcatgatgcatgccatggaagttactcttccaagaattgggtc
aatcaaaccttgggtttgactttaaataccttgggcggaaattcatttatttggaaacag
aaacataatatagttcaccatacctatactaatgtagacggggtagatgacgacattgcc
aaatcgccttttatccgtcattgcagtacgcaaaaatggaacccgatgcataggtatcag
cacttatatattatatttttatacgcgatttcttcttttgcctgggtcttcttttttgat
tttgagaaatatttaaagaaacgtgttcataccacccagttgcagaaaatgcaattttcg
gatcacctggttttctggtttagcaaggtaatgtacctggtattttatgtcgggctcccg
gtattgttattgggatggaaaccttggttgatcggtttcgtagcaatgcacctggtgatg
ggctttaccttggctatagttttccagttggcgcatgttgttgaagaaacctcttttgag
ttcgtacacgaagatgataaagtaatagaaaatgaatgggctattcaccaagtgaataca
acttctaactttgcaccgggtaacgccattatttcatggtgggcaggcggcttaaattac
caggtagaacatcacttgttcccccgtattagccatgtacattatccggagttgagtaag
atcgtgcggatgaaatgtgaagaatttggagtaaaatataacagtatgccaactatgttc
gaagctgtgcgttcccattttaggtttatcaaggagttgggtcaacgaccggcaggcata
taa

DBGET integrated database retrieval system