KEGG   Chitinophaga caeni: COR50_09250
Entry
COR50_09250       CDS       T05360                                 

Definition
(GenBank) hypothetical protein
Organism
cbae  Chitinophaga caeni
SSDB
Motif
Pfam: LysM Glucosaminidase
Other DBs
NCBI-ProteinID: ATL47341
UniProt: A0A291QTV2
LinkDB
Position
2209024..2210508
AA seq 494 aa
MRKCCWIFLFVFGFTAISRAQKITPTQYIEMYKDLAIAEMKRSGVPASIKLAQGIIETQA
GNSWLVINSNNHFGIKCKNNWGGESVYYDDDEKGECFRKYPSAYDSYKDHSDFLRNNPRY
GFLFKYDVKDYKSWAYGLKQAGYATSKTYTQHIISTIEKYHLEDVTLEGLRDKSSYAEYA
ASHHIKEQPAYAVQTPGYTKPGTTTNNKPLPEPRNVTYPSHGTFEINGRKAIYVAAGSSM
IQLAKEHKIRLSRLVQYNDLPNDNPPGKAMVLFLQKKNKKGKTDYHLVAKGESMHDIAQA
EGIQMRWLLRRNKMKEGDEPTPGQRLALNGYASRTPELLAKGMDPDDAGDASDGFIKEIT
STGKDIVQNTANNSNTDEIAGNSNQGQVQKNGTRPGPSAPRDVPAVEKRGPDPVQKTIPA
TSNSEPQPVSTGQQKPSQPQPGNLPAGMSYHEVVEKDTLYNISKRYNVTVAQIREWNHLP
GYDIQIGQRLIIRK
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcgtaaatgttgctggatattcctgtttgtatttggcttcacggccatttcgcgggcg
caaaagattacgcctacccaatatatcgagatgtacaaggatttagccattgccgaaatg
aagcgcagtggtgtgcctgcttccatcaaattggcccagggcataatcgaaactcaagcc
gggaatagttggcttgtgatcaactccaataatcacttcggtataaaatgtaaaaataac
tggggcggtgaatccgtgtattacgatgatgatgaaaaaggggagtgctttaggaaatac
cccagcgcttacgattcatataaagatcattctgattttttaagaaacaatccccgttac
gggttcctgtttaaatatgatgtcaaagattataaatcctgggcatacgggttgaaacag
gcgggttacgctaccagtaaaacatatacgcaacatatcatttccacgatagagaagtac
catctggaagatgtaacattagaaggtttgcgggataaaagctcttacgccgaatatgct
gctagccaccatattaaggaacagccggcatatgccgtgcaaactcccggttatacaaag
cccggtacaactactaataataaaccgctcccggaaccgcgcaatgttacctaccccagc
catggtaccttcgaaatcaacggccgcaaagccatttacgttgccgcgggaagctccatg
atccaactggcaaaagagcataagatcaggttgagccggttagtacaatacaatgatctg
ccaaacgataatccccccggaaaagcaatggttttattccttcagaagaaaaataagaag
ggcaaaacggattatcacctggtggccaaaggcgaatctatgcatgatattgcccaggct
gaaggtatccagatgcgttggctgttgaggaggaataagatgaaagagggcgatgaacca
acaccgggacagcgtttagccttgaatggctatgcatcccgaacacccgaattgcttgcg
aagggaatggatccggatgatgcgggggatgctagtgatggattcatcaaggagattact
tctacaggtaaagatatcgtgcaaaatacagccaataattccaatacggatgaaattgct
ggaaattctaaccaggggcaggtacagaaaaacggaacccgcccgggaccatcagctccc
agggatgttcctgccgtggaaaaaaggggcccggacccggtacaaaaaacgattcctgcc
acttccaatagtgaaccgcaaccggtatccacggggcagcaaaagccctcacaaccacag
cctggcaatctgccggctggtatgagttaccacgaggtagtggagaaagataccctttat
aatatatcaaagcgttataatgtgacggtagcgcagatcagggaatggaatcatttaccg
ggatatgatatacaaattgggcaacggttgatcatccggaagtaa

DBGET integrated database retrieval system