KEGG   Chitinophaga caeni: COR50_09345Help
Entry
COR50_09345       CDS       T05360                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cbae  Chitinophaga caeni
Pathway
cbae00061  Fatty acid biosynthesis
cbae00780  Biotin metabolism
cbae01100  Metabolic pathways
cbae01130  Biosynthesis of antibiotics
cbae01212  Fatty acid metabolism
Module
cbae_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    COR50_09345
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    COR50_09345
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    COR50_09345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbae01004]
    COR50_09345
Enzymes [BR:cbae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     COR50_09345
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     COR50_09345
Lipid biosynthesis proteins [BR:cbae01004]
 Fatty acid synthase
  Component type
   COR50_09345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ATL47357
UniProt: A0A291QTU6
LinkDB All DBs
Position
2234686..2235492
Genome map
AA seq 268 aa AA seqDB search
MAQNLLQGKKGIIFGALDEKSIAWKTAKRCVEQGAQIVLTNAPIALRMGEIKKLAEECNA
PVIPADITNMDDLNNLFTQSMEHFGGKIDFVLHSVGMSINMRKGRPYTDLDYDFTHKTMD
ISAISLHRVLQTAYKLDALNEHASVVALTYIAAQRVFPDYSEMADAKAMLESVARSFGYH
YGIKNKVRINTISQSPVRTTAGSGVKGFDDFINFAEEMSPLGNASADQCADYTVTLFSDL
TRMVTMQNLYHDGGFSSTGVTMAVLDKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaacttattacaaggtaagaaaggcatcatctttggtgcgttggatgaaaag
tccattgcctggaaaaccgcgaagcgttgtgtggaacaaggtgcacagatcgtattgacc
aacgctcccatcgctttacgtatgggcgaaatcaagaaactcgctgaagaatgtaatgcc
ccggtaatacctgcggatatcacgaatatggatgacttgaataacttattcacacaatcc
atggaacattttggcggtaagatcgatttcgtactgcattctgtcggaatgagtatcaat
atgcgtaaaggcagaccatatacagatctggattacgattttacgcataaaaccatggac
atttccgctatctcattgcacagggtgttacaaacagcctataagctggatgcgttaaat
gaacatgcttcggtggttgccttgacttatattgcagctcaaagggtattccctgattac
agcgagatggcagatgctaaggccatgttggaatctgtagcccgtagcttcggttaccat
tacggtatcaagaataaggtgagaatcaacacgatttcccaatcaccggtaagaacaact
gccggcagtggggtaaagggtttcgatgattttatcaacttcgcggaagaaatgagcccg
ctgggtaatgcttcggccgaccaatgtgcggattataccgttacgctgttctccgattta
accaggatggtgaccatgcagaacttgtaccatgacggtggattctcttctaccggtgta
actatggccgtattagacaagaaataa

DBGET integrated database retrieval system