KEGG   Chitinophaga caeni: COR50_09615Help
Entry
COR50_09615       CDS       T05360                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbae  Chitinophaga caeni
Pathway
cbae00564  Glycerophospholipid metabolism
cbae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    COR50_09615
Enzymes [BR:cbae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     COR50_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA HI0933_like Pyr_redox_3 NAD_binding_8 FAD_binding_3 YdjC Pyr_redox Thi4
Motif
Other DBs
NCBI-ProteinID: ATL47407
UniProt: A0A291QTZ7
LinkDB All DBs
Position
2287359..2288927
Genome map
AA seq 522 aa AA seqDB search
MMRENLLAQFKSKIDQEWDVVVIGGGATGIGAALEAVTRGYKTLLVEKADFAKSTSSKST
KLVHGGVRYLAQGDVALVREASVERGLLLKNAPHLAHNLSFVIPAYSWFDGIFYTIGLKL
YDWMAGRLSLGRSLYISRKKTIERLPTIKQDHLSAGVLYHDGQFDDSRLAINLVQTFLEH
GGIAINYMEVKAMEKDITGKLSGLKLQDNETGEVFHVKTKGVINATGVFTDDVLQMDDPN
EPRSIVASQGVHLVLDHSFLPGKTALMIPKTSDGRVLFAVPWHNKLVVGTTDTLVESISL
DPVALEKEIQFILDTADQYLTKAPKRTDVLSVWAGLRPLAAPTGEKAKTKEISRNHKIMV
TPSGLVSILGGKWTTYRRMGEDVVTKLEEVHQWKKTTTATKFLPIHGFVENTDENNPLYF
YGADMPGIQALAASEPGMSEVLSESLQIIAAQVAWAVRHELAQQVEDVLARRIRALFLDA
HEAVRIAPKVAAIMAKELNKDTTWEQEQIQSFNTLASTYMLS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgggaaaatttattagcacagtttaaatcgaagatcgaccaggaatgggatgtg
gttgttattggtggaggtgctaccgggatcggtgctgcacttgaagcagttaccagggga
tataaaaccttgttggttgagaaagcagattttgcaaaatctacatccagcaaaagcacg
aagttggtgcatggcggcgtgcggtacttggctcaaggggatgtagccctggtgcgggaa
gccagcgttgaaaggggattactattaaaaaatgccccgcatttagcgcataacctttcc
ttcgtaattccagcatattcatggtttgatgggatcttttatacaatcgggttaaaactc
tacgactggatggcagggcgattaagccttggccgttccttatatatttcccgtaaaaaa
actatcgaacgtttacctacgattaagcaagatcacctttctgctggggtattatatcat
gatggccaatttgacgattcccgcctggctattaacctggtgcaaactttcttggagcat
ggcggcatcgctattaactacatggaagtgaaggcgatggaaaaggatataactgggaaa
ttgagcggccttaaacttcaggataatgaaaccggtgaagtatttcatgtaaagacaaaa
ggtgttattaacgctaccggcgtatttacagacgatgttttgcaaatggatgatcctaat
gaaccccgttctatcgtggccagtcaaggagtacacctggtattggatcatagcttcctc
ccgggaaagacggcgttaatgattcccaagaccagtgatggcagggtgctttttgcagtt
ccatggcataataaattggtagtaggtactaccgatactctcgtcgagagcattagcctg
gatcccgtagctttagaaaaggagattcaatttattctcgatacagccgatcaatatctt
acgaaagcacctaaaagaacggacgtgttgagcgtttgggccgggcttagacctttggca
gcgcctacgggagaaaaagccaaaacgaaggaaatttcaaggaaccataaaataatggta
acgccttcaggtttggtaagtatcctcggtggtaaatggacaacataccgtagaatgggt
gaagatgtagttacgaagctcgaagaagtgcaccagtggaagaaaacgactaccgcgaca
aaattcctcccgattcatggtttcgtcgaaaacaccgatgaaaacaaccccctatatttt
tatggcgccgatatgcccggcattcaagcattagccgcttctgaacccggaatgagcgag
gttttatctgaatccctccaaatcatcgcggcacaagtggcttgggcggtgaggcatgag
ttggcgcaacaggttgaagatgtgttggcgagaaggatcagggcccttttcctcgatgcc
cacgaagcggtacgcatagcgccgaaagtggctgctatcatggccaaagagttgaataaa
gatacaacctgggagcaggaacaaattcaatcattcaataccttggcatccacctacatg
ctaagctaa

DBGET integrated database retrieval system