KEGG   Chitinophaga caeni: COR50_13420Help
Entry
COR50_13420       CDS       T05360                                 

Definition
(GenBank) ferredoxin
Organism
cbae  Chitinophaga caeni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_7 Fer4 Fer4_8 Fer4_10 Fer4_9 Fer4_2 Fer4_4 Fer4_3 Fer4_16 Fer4_17 Fer4_21 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ATL48083
UniProt: A0A291QW49
LinkDB All DBs
Position
3187856..3188203
Genome map
AA seq 115 aa AA seqDB search
MAIKITDECINCGACEPECPNNAIYEGGVEWALADGTTVKGAFTLMDGSMMDADQRNAPI
SVDTYYIVPNKCTECQGFHEEPQCAAVCPVDCCVPDEMYQETVDELMAKKDKLHL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaagataactgacgaatgtataaactgtggtgcctgcgaaccggaatgcccc
aataatgctatttatgaaggtggtgtagaatgggctttggccgatggtactacagtaaaa
ggtgcgtttacactaatggacggttctatgatggatgctgatcaaagaaatgcaccaatt
agcgtagatacttattacattgttccgaataaatgtacagaatgccaaggtttccacgaa
gaacctcaatgcgctgccgtttgcccggttgactgttgtgttccggacgaaatgtaccaa
gaaacagttgatgaactgatggctaaaaaagataaattacacctgtaa

DBGET integrated database retrieval system