KEGG   Chitinophaga caeni: COR50_13430Help
Entry
COR50_13430       CDS       T05360                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cbae  Chitinophaga caeni
Pathway
cbae00473  D-Alanine metabolism
cbae00550  Peptidoglycan biosynthesis
cbae01100  Metabolic pathways
cbae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    COR50_13430
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    COR50_13430
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    COR50_13430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbae01011]
    COR50_13430
Enzymes [BR:cbae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     COR50_13430
Peptidoglycan biosynthesis and degradation proteins [BR:cbae01011]
 Precursor biosynthesis
  Amino acid ligase
   COR50_13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: ATL49868
UniProt: A0A291R0Z4
LinkDB All DBs
Position
3188829..3189821
Genome map
AA seq 330 aa AA seqDB search
MKKNIALLAGGYSGEFEVSMNSANTVQKHLDAQLYEVYKIVITKKDWTYTGASGENIPVD
KNDFSLTINGEKIKFDAAFIIIHGTPGEDGLLQGYLDMLDIPYTNCGLMSSALTFNKSYC
NKVVAALDIIHVAKSAHLFKGKAYDTASILQALELPLFVKPAGGGSSIGMTKVKTAEELP
GAIERAFREDVQVLVEEFMSGREFSCGAFTEQGAVKVLPITEIISKKEFFDYEAKYTPGM
SEEVTPANVPPAMAAKAQGIIAKLYDALNCKGMVRIDFIWDESKDKLYFLEVNTTPGQSE
ASIIPQQVRAAGMNLGQFYGNLIEECLRKS
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaatatcgcgctcttagcaggtggttattcaggagaatttgaagtctccatg
aacagtgcaaatacagtgcagaagcacttggatgcacaattatacgaagtatacaaaatc
gttattacgaagaaagactggacttatacaggggcttcgggggaaaatatcccggttgat
aaaaacgatttttccctaactattaatggggaaaagataaaatttgatgcggcatttatt
attatccatggaaccccgggcgaagatggcctgttgcaaggctacctggatatgctggac
attccctatactaactgcggattgatgagctcggcgctcacttttaataaaagctattgt
aacaaggtcgtggcggcactggatattatccacgttgctaaaagcgcccacctttttaaa
ggcaaagcctatgatacggcatcaattttgcaagccttggaactgcctttgttcgtgaag
cctgccggcggtggatccagtatcggtatgacgaaggtaaaaaccgccgaggaactaccg
ggcgctattgaaagggccttccgggaagatgtccaggtgcttgttgaagaatttatgtcg
ggccgcgaatttagctgcggcgcttttacggaacaaggagctgtaaaagtattgcctatt
acggagattatttctaaaaaggaatttttcgactacgaagcaaaatatacacccggcatg
agcgaggaagtgacgccggccaatgtaccgccggctatggctgccaaagcacaggggatc
attgccaagttatacgatgcattgaactgtaaaggaatggtgaggatcgattttatttgg
gatgaatccaaagataaattgtattttttggaggttaatacgacccccgggcagtctgaa
gccagcattatcccgcaacaggtaagggctgcgggcatgaatttgggtcaattctatggt
aacttgatcgaggaatgcctccgcaaatcatag

DBGET integrated database retrieval system