KEGG   Chitinophagaceae bacterium 13: COR50_15595Help
Entry
COR50_15595       CDS       T05360                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cbae  Chitinophagaceae bacterium 13
Pathway
cbae00010  Glycolysis / Gluconeogenesis
cbae00053  Ascorbate and aldarate metabolism
cbae00071  Fatty acid degradation
cbae00280  Valine, leucine and isoleucine degradation
cbae00310  Lysine degradation
cbae00330  Arginine and proline metabolism
cbae00340  Histidine metabolism
cbae00380  Tryptophan metabolism
cbae00410  beta-Alanine metabolism
cbae00561  Glycerolipid metabolism
cbae00620  Pyruvate metabolism
cbae00625  Chloroalkane and chloroalkene degradation
cbae00903  Limonene and pinene degradation
cbae01100  Metabolic pathways
cbae01110  Biosynthesis of secondary metabolites
cbae01120  Microbial metabolism in diverse environments
cbae01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cbae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COR50_15595
   00053 Ascorbate and aldarate metabolism
    COR50_15595
   00620 Pyruvate metabolism
    COR50_15595
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COR50_15595
   00561 Glycerolipid metabolism
    COR50_15595
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COR50_15595
   00310 Lysine degradation
    COR50_15595
   00330 Arginine and proline metabolism
    COR50_15595
   00340 Histidine metabolism
    COR50_15595
   00380 Tryptophan metabolism
    COR50_15595
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COR50_15595
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COR50_15595
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    COR50_15595
Enzymes [BR:cbae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     COR50_15595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ATL48469
UniProt: A0A291QWR4
LinkDB All DBs
Position
3726527..3728053
Genome map
AA seq 508 aa AA seqDB search
MQNILQQFQLTGTHAGVSTGSSWLQSTGQSIDSMSPVDGKLIAGVQSADRASYDAAIESA
QAAYLKWRAIPAPRRGEIVRQIGESLRKNKEALGRLVSFEMGKSLQEGFGEVQEMIDICD
FAVGLSRQLHGLTMHSERPGHRMYEQWHPLGIVGIISAFNFPVAVWSWNSMLAWVCGNVC
IWKPSEKTPLTAIACQKITAEVFAANDIPEGVSCLVIGGRDVGEWMAQDKRIPLVSATGS
TRMGKSVAATVASRLGKSLLELGGNNAIIITPDADLDMSLIGAVFGAVGTAGQRCTSTRR
LIIHEDVYDAFVSKLVNAYGQLRIGDPLDENNHVGPLIDTDAVKAYLTSIEECKAEGGKF
LVEGGVLKGAGFESGCYVKPCIAEVENHYKIVQHETFAPILYVMKYKTLDEAIAMQNGVP
QGLSSAIMTTNLREAEQFLSNAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDA
WKAYMRRQTNTINYSTHLPLAQGIKFDL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacatcttacaacaattccaattaacaggaacccatgccggtgtgtcaaccggt
tctagctggttacagtcaacaggtcaatccattgactccatgtccccggtagacgggaaa
ttaattgccggcgtgcaaagtgcagacagggcttcatacgatgctgccatcgaatctgca
caagcagcttaccttaaatggagggcgatcccggctccaaggcgcggtgaaatagtacga
caaatcggtgaatctttacgtaaaaataaagaagcactcggaaggctggtttcctttgaa
atgggaaaaagcttgcaggaaggcttcggtgaagtacaggaaatgatcgatatctgcgat
tttgccgtgggtttatcccgccaattacacggcttgacgatgcattcggaaaggccgggt
catagaatgtacgaacaatggcacccccttggcatcgtgggaattatttcggcctttaat
ttcccggtagcggtatggagctggaatagtatgctggcttgggtatgcggaaatgtatgc
atctggaaaccatcagagaaaacgccgcttactgcaattgcctgccaaaaaattacagcg
gaagtcttcgcagctaatgatatccccgaaggtgtttcctgcttggtaataggcggtcgc
gatgtaggtgaatggatggcccaagataagcgcatccccttggtatcagccaccggttct
acgaggatgggtaaaagtgtagctgccaccgtagcatccaggctcgggaaatcattgttg
gaactgggtggtaacaacgccataatcattacgcccgatgccgatttggatatgtcatta
atcggcgccgtatttggtgctgtcggtaccgcggggcaacgttgtacttccacccgccgc
ttaatcattcatgaagatgtatacgatgctttcgtgtccaagctggtcaatgcttatgga
caattacgaatcggtgatccattagacgaaaataaccatgtaggtccattgattgatacg
gatgcagtgaaagcgtaccttacatctatcgaagaatgtaaagctgaaggtggtaaattc
ttggtggaaggcggtgttttaaaaggcgcgggattcgaatctggatgctatgtgaaacct
tgcatcgcggaagtagaaaaccattataaaatcgttcagcacgaaacttttgcaccgatt
ttatacgtgatgaaatataaaactttggatgaagcaatagccatgcaaaatggagttccg
caaggactgtcctctgctatcatgaccactaacttgcgggaagccgagcagttcctttcc
aatgccggtagcgactgtggaatcgccaatgtcaatatcggtacttcaggggctgagatc
ggcggggctttcggtggagaaaaagaaaccggcgggggccgcgaaagtggatccgatgca
tggaaggcatacatgcgcaggcaaacaaatactattaactatagtactcatttgccttta
gcacaaggcattaagttcgatttatag

DBGET integrated database retrieval system