KEGG   Cellulophaga baltica NN016038: M667_01660Help
Entry
M667_01660        CDS       T03562                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00010  Glycolysis / Gluconeogenesis
cbal00020  Citrate cycle (TCA cycle)
cbal00620  Pyruvate metabolism
cbal01100  Metabolic pathways
cbal01110  Biosynthesis of secondary metabolites
cbal01120  Microbial metabolism in diverse environments
cbal01130  Biosynthesis of antibiotics
cbal01200  Carbon metabolism
Module
cbal_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M667_01660
   00020 Citrate cycle (TCA cycle)
    M667_01660
   00620 Pyruvate metabolism
    M667_01660
Enzymes [BR:cbal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M667_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C RnfC_N
Motif
Other DBs
NCBI-ProteinID: AIY12032
LinkDB All DBs
Position
complement(370334..371968)
Genome map
AA seq 544 aa AA seqDB search
MAIVINMPRLSDTMEEGTVAKWLKNVGDKVEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGDGAPVDTLLAIIGEEGEDISALLNGASAPEAKAEEKQEESAAEPEPVASEASESVE
IPEGVEIIKMPRLSDTMEEGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFYSGTLL
YIGTQEGESSPVDVILAIIGPEGTDVDALLASKPSSAAPKAAAAAPKETAKTESKAAPSA
PAETKEVVANDGQRIFVSPLAKKIASEKGVNLRDVTGSGDNGRIVKKDVENFVPAPKAAA
PAAKASGAGAPLALPVGEESVEDVKNNQMRKVIAKRLGESKFTAPHYYLNIEVDMDNAKA
SRVQINSLPDTKVSFNDMVVKACAMALRKHPQVNTSWNGDTTRYNHHISVGVAVAVEDGL
VVPVLKFTDQMGLSQIGASVRDLAGKARTKKLTPAEMEGSTFTVSNLGMFGVESFTSIIN
QPNSAILSVGAIVEKPVVKDGQIVVGNTMKLTLACDHRTVDGATGAQFLQTLRAFIENPV
TMLA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtaataaatatgccgagacttagcgataccatggaagaaggtacagtcgct
aagtggttaaaaaacgtaggcgataaagttgaagaaggtgatattttagcagaaatagaa
accgacaaagcaaccatggaatttgaatctttcaatgaaggaacattacttcatattgga
atacaagaaggagatggtgcgccagtagatactttactagctattataggtgaagaagga
gaagatatttcagcattattaaatggtgcttcggctcctgaagctaaagcggaggaaaag
caggaagaatctgctgctgaaccagaaccagttgctagtgaagcttcagaatctgttgaa
attccagaaggggtagagattataaaaatgccgcgcttaagtgataccatggaagaaggt
accgttgcttcttggttgaaaaaagtaggcgataaagttgaagagggtgatatccttgct
gaaatagaaacagacaaagctacgatggagtttgagtctttctattcaggaaccttatta
tacataggaacacaagaaggagaatcttctcctgttgatgttattttagctattattggc
cctgaaggtacagacgttgatgcacttttagcatcaaagccatctagcgcagctccaaag
gcagctgcagcagctcctaaagaaactgcaaaaactgaaagtaaagcagcgccaagtgct
cctgctgaaactaaagaggttgtagcaaacgacgggcaaagaatatttgtttctccatta
gctaagaaaattgcttcagaaaaaggagtaaatttaagagacgttactggatcaggagac
aatggaagaattgttaagaaagatgtagaaaactttgttccagctccaaaagcagcagct
ccagcagcaaaagcttctggtgcaggtgctccactagcattgccagttggtgaggaaagt
gttgaagatgttaagaacaatcaaatgcgtaaggttattgctaagcgtttgggagaatct
aagtttacagcaccacattactacctgaatatagaggtagatatggataatgcaaaagct
tcaagagtacaaattaatagcttaccagatacgaaagtttctttcaatgatatggtggta
aaagcttgtgctatggcgcttagaaagcacccacaagtaaatacctcatggaatggagat
acaacacgttacaatcaccacattagtgtaggagtagcagttgctgttgaagatgggctg
gtagttcctgtattgaaatttacagatcaaatgggattatctcaaattggtgcttctgtt
agagatttagccggaaaagctagaactaagaaattaacacctgccgaaatggaaggaagt
acatttacggtgtctaacttaggaatgtttggagttgagagttttacctccatcatcaat
cagccaaattcagcaattctttctgtaggcgcaattgtagagaaaccagtagttaaagac
gggcaaattgtagtgggtaataccatgaaattaacgcttgcttgtgatcatagaactgta
gatggcgcaacaggagctcaattcttacaaacgttacgtgcgtttattgagaatccagtg
actatgttggcttaa

DBGET integrated database retrieval system