KEGG   Cellulophaga baltica NN016038: M667_07405Help
Entry
M667_07405        CDS       T03562                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00020  Citrate cycle (TCA cycle)
cbal00310  Lysine degradation
cbal00380  Tryptophan metabolism
cbal01100  Metabolic pathways
cbal01110  Biosynthesis of secondary metabolites
cbal01120  Microbial metabolism in diverse environments
cbal01130  Biosynthesis of antibiotics
cbal01200  Carbon metabolism
Module
cbal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M667_07405
  09105 Amino acid metabolism
   00310 Lysine degradation
    M667_07405
   00380 Tryptophan metabolism
    M667_07405
Enzymes [BR:cbal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     M667_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIY13052
LinkDB All DBs
Position
1728082..1730871
Genome map
AA seq 929 aa AA seqDB search
MDKYSFLNAAHTSFFAELYDKYLINPDSVEPSWRAFFQGFDFGQESLLDELDLPVTPNNV
AAPSGTSEMPQSLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRKYEPTLAIENFGLSSGD
LNTVFTAGEILGIGPSTLTEIISHLTNIYCDAIGVEYMYIRNPERIEWIQNWLNVNDNHP
NYDNERKKNILRKLNQAISFESFLHTKYVGQKRFSLEGNESLIPALDAIVERAAEMGVEQ
FVMGMAHRGRLNVLTNIFGKAAKDIFSEFDGKDYEQVIFDGDVKYHLGWTSDRMSDNGNK
IKMNIAPNPSHLETVGAVVEGITRAKQDAHYKDDFSKVLPIVVHGDAAIAGQGLVYEVIQ
MASLDGYKTGGTIHMVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVH
ASLFALEYRMRFQRDVFLDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHENPRDIYAAKLI
AEGIIDENYISKLEQEYKDSLETELEDSRKEDKTVITPFMADEWKGFVSVQEDEMVKPID
TSYPKEKLTQIANSLTSLPKGKKFLRKVDKLVEDRRKMFFENDSLDWAMGELLAYGSLLQ
EGFGVRMSGQDVERGTFSHRHAVVKVEDSEEEVVPLNLVEGKKGDFHIFNSHLSEYGVVG
FDYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQG
AEHSSARMERFLQLCASDNMFIADVTTPANMFHLLRRQMKANFRKPLVVFTPKSLLRHPK
AVSSIEEFATGGFQEVIDDAAADVKKVKTLVFCTGKFYYDLLAAREEHTREDVALVRVEQ
LFPLPAQKMKAIMKKYAEADDVVWAQEEPRNMGAWSHIMMHFSEASTLRVASRRFYASPA
AGSAVRSKRRHQEVIDYVFDKSKDNMIRK
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgctgcgcatacttcattttttgcagagttatatgac
aagtatttgattaatccagatagtgttgagcctagttggcgcgcattttttcaaggattt
gattttggccaagagagtcttttagatgaacttgacttgccagtaacaccaaataatgtt
gctgcaccatctggcacttcggaaatgccacaatcactacaaaaagaatttcaggttatt
cggttaatcgatggatatcgatctcgtggacatttgtttacaaaaacaaatccggttcga
gaaagaagaaaatatgagccaacgcttgctatcgaaaatttcgggttatcatctggagat
ttgaatactgtttttacagcaggagaaattttaggaatagggccaagtaccttaactgaa
attatttcgcacttaacaaacatttattgtgatgccataggtgttgaatacatgtatatc
agaaatccggaacgtattgagtggattcagaattggctaaatgtcaatgataaccaccca
aactatgataacgaacgtaagaaaaatattcttagaaaattaaatcaagccatctctttt
gagagctttttgcataccaaatatgtaggccagaagcgattttcattagagggtaacgag
tcgcttattcctgcattggacgctattgttgagcgtgcagcagaaatgggagtagagcag
tttgttatgggtatggcgcatagaggtagactcaatgtgcttactaatatttttggtaaa
gctgctaaagatatcttcagtgagtttgatggtaaagattacgagcaagtaatttttgat
ggtgatgttaaatatcacttaggttggacttcagatagaatgtctgataatggaaataaa
ataaaaatgaatattgctcctaatccatctcacttagagactgtaggggctgttgttgag
ggtattacaagagcaaaacaagatgcgcactataaagatgatttttctaaagtgttgcct
attgttgtacatggagatgctgccattgcaggtcagggtctagtgtatgaagtaattcaa
atggctagcttagacgggtacaaaactgggggtactatccatatggtagtaaataaccaa
attggttttaccactaattatctggatgcacgtagttctacgtattgtacagatgttggt
aaagtaaccttgagtccagtattgcatgttaatgcagatgatgcagaagcggtagtacat
gcttctttatttgctttagaatatagaatgcgttttcaacgcgatgtgtttcttgattta
ttaggataccgtaagtatggtcataatgaaggtgatgagcctcgttttacacaaccaaaa
ctttataaggcaattgctaagcatgaaaatcctagagatatttatgcggcaaaacttatc
gcagaaggtattatagatgaaaactatattagtaaattagaacaagaatataaagattct
cttgaaacagaattggaagattctcgtaaagaagataaaacagtcatcacaccttttatg
gcagatgagtggaaaggttttgtaagtgttcaagaagatgaaatggtaaagccaattgat
acttcttatccaaaagaaaaacttacgcaaatagcaaactctcttacgagcttaccaaag
ggtaaaaagtttttacgcaaagtagataagcttgtagaagatcgtagaaaaatgttcttc
gagaatgacagcttagattgggctatgggagaacttttagcctacggatctttgcttcaa
gaaggttttggagttagaatgtctgggcaggatgtagaaagaggtactttttcacatcgt
catgccgttgtaaaagtagaggatagtgaagaagaggttgttcctttaaaccttgtagag
gggaaaaaaggagattttcatatctttaactcacacctttcagagtatggggtggtaggt
tttgattatggatacgctatggctagtcctaatacgcttacgatttgggaagctcagttc
ggtgattttagcaacggtgctcaaatcatgatagatcagtatatttctgctgctgaagat
aagtggaagttgcaaaacggattggtaatgttattgccgcacggttatgaaggtcaaggt
gcagaacattcttctgcgcgtatggagcgtttcttgcaactttgtgctagtgataatatg
tttatagcagatgttactacgccggctaacatgtttcacttgttacgtagacaaatgaag
gctaactttagaaaacctttggtggtgtttacaccaaaaagtttattacgtcatccaaaa
gctgtttcttctatagaagaatttgcaacaggtggttttcaagaggtgatagacgatgct
gcagccgatgttaaaaaggtaaaaactttggtattctgtactggtaaattctattatgat
ttactggctgcacgtgaagaacatactagagaagatgtggccttagttcgtgtagaacag
ttatttcctttgccagcacagaaaatgaaggcaattatgaaaaagtatgctgaagcagat
gatgttgtttgggcacaagaggagcctagaaacatgggagcttggagtcatattatgatg
cactttagtgaagcaagtacattaagagtagcttcaagacgtttttatgcatcaccagca
gccggtagtgcagtgcgttctaaacgtcgtcatcaagaagttatagattatgtttttgat
aagtcaaaagataacatgatccgtaagtag

DBGET integrated database retrieval system