KEGG   Cellulophaga baltica NN016038: M667_08640Help
Entry
M667_08640        CDS       T03562                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00591  Linoleic acid metabolism
cbal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    M667_08640
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cbal01004]
    M667_08640
Enzymes [BR:cbal01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     M667_08640
Lipid biosynthesis proteins [BR:cbal01004]
 Desaturase
  Front-end
   M667_08640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Na_H_antiporter DUF2207 DUF5313
Motif
Other DBs
NCBI-ProteinID: AIY13272
LinkDB All DBs
Position
complement(2003225..2004325)
Genome map
AA seq 366 aa AA seqDB search
MTKETVRFSRKDSTQFFKTLNKRVNDYFKENKIKKTGDWRLHLKTAVMFALFLAPYFLIL
TLNLPNWANLLLTILIGIGMAGVGMNVMHDGNHGSYSNKKWVNKLMGGSIYILAGNVFNW
QVQHNVLHHTYTNIHEHDEDLEAGRILRFSKHAEWRKHHKFQHFYSVFLYGLLTFNWAIT
TDFQQMYRYTKRKLSYGELPNPFVNWSKLVITKIIYLTIWIVLPMLILSIAWWKILIGFF
IMHYVAGVILSVTFQLAHVVEDADTPLPDENGNMKNTWAIHQLFTTVNFGTKNRIVNWFT
GGLNHQVEHHIFPNISHVHYTKIAKIVKETANEFNLPYNEYKTTRKAIISHFSHLKELGK
KPSIQY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaaaccgttcgattttccagaaaggattctacccaattctttaaaacatta
aacaagagggtaaacgattacttcaaagagaataaaataaaaaaaacaggagattggaga
ttacacttaaaaacagctgtaatgttcgctttatttttagcaccctattttctaatactt
actttaaacctacctaactgggctaacttattacttaccattcttatcggaataggtatg
gcaggtgttggtatgaatgtaatgcatgatggaaatcatggttcttactctaacaaaaaa
tgggtaaataaattaatgggaggtagcatttacattcttgcaggtaacgtatttaactgg
caagtacaacacaatgtactacaccatacatataccaatattcatgaacacgatgaagat
ttagaagccggaagaattcttagattctctaagcatgcagaatggagaaaacaccataaa
tttcagcatttctattctgtatttttatacggattattaacgtttaactgggccattact
accgattttcaacaaatgtaccgctacacgaaacgtaagctgtcttacggtgaactacca
aacccttttgtaaattggagcaaactggttatcacaaaaattatatacctaacaatatgg
attgttcttccgatgcttattttaagcattgcttggtggaaaatactaataggctttttt
atcatgcactatgtggctggtgtaatcttaagtgtaacctttcaattagcgcatgttgtt
gaagatgctgacactccattaccagatgaaaatggcaatatgaaaaacacgtgggcgatt
caccaactgttcactacggttaattttggaactaaaaacagaattgtgaactggttcaca
ggaggactaaaccaccaagttgaacatcatatttttcctaatattagtcatgttcattac
acaaaaattgctaaaattgttaaagagactgcaaatgagtttaatttgccttacaacgaa
tacaagacgacgagaaaagctataatttcgcactttagtcatttaaaagaactaggcaaa
aagccttcgatacagtattag

DBGET integrated database retrieval system