KEGG   Cellulophaga baltica NN016038: M667_09065Help
Entry
M667_09065        CDS       T03562                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00620  Pyruvate metabolism
cbal00680  Methane metabolism
cbal01100  Metabolic pathways
cbal01120  Microbial metabolism in diverse environments
cbal01200  Carbon metabolism
Module
cbal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M667_09065
  09102 Energy metabolism
   00680 Methane metabolism
    M667_09065
Enzymes [BR:cbal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M667_09065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIY13351
LinkDB All DBs
Position
2094542..2097088
Genome map
AA seq 848 aa AA seqDB search
MKQVQRLEEFKKSVNNKFNVYNSLFLNLPYRNIENVGMVIPLMLDQCQKGLKSGQNPKEI
LEAFFENFMAIDSEKERIDFMFRIIQYVERQVVLYDSVEDAAFPKIYKHSNNLAIKDYFE
LVDKNKSWDKISDHLSNFSARLVLTAHPTQFYTPAVLDIIAELRTLILGDKIDDIDVTLQ
QLGLTSLINSKKPTPLDEAKNIIYILRNVYYDAVGELYAYLKSNINNAEFENYNIMKLGF
WPGGDRDGNPFVTADITNDVADELRITLMKCYYNDLKKLQQKLTFSGLQEDINKLRANLY
TAMFNPEKQVGYQDIIGPLTQIRAVLVERYHSLYLEELDYFIDKVKIFKTHFATLDIRQD
HSMHVKVITEILTRNGLIKENLDELSEKELIDILLNEKLSLKVFDYNEEITQETIKNILQ
LKSIQEKNGEEGCNRYIISNSEDIFSVLFVFALFRWCGWNAKEISFDIVPLFETMKGMED
SEAIMQQLFDMPEYMAHVRQRSEKQTMMLGFSDGTKDGGYLKANWSILKTKESLSGVCAK
NNIKAIFFDGRGGPPARGGGKTHRFYAAQTKDIANNEIQLTIQGQTITSTYGTKEQFVYN
CEQLLTAGLSNSFYGDENVITENQRTLIEQLSELSFEKYDALKHHDKFMPYLENMSTLKY
YTKANIGSRPGKRGNKAKLELSDLRAISFVGSWSQLKQNVPGYFGLGTAIKTMKDKGKMD
EVKNLYEKVPVFRALMSNSMMALSKCYFELTAYMRDDEEYGDFWIILKNEYDLSKEMLLE
ISGMEILMEQEALSRESIKIRENIVLPLLVIQQYALQKIGEDSPMKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtacagcggttagaagaatttaagaagtcggtaaacaataagtttaatgtt
tacaacagtttgtttttaaacttaccataccgaaatatagaaaatgtgggtatggttatt
ccgttgatgttagaccaatgtcaaaagggattaaaatcgggacaaaatcctaaagaaatt
ttagaagctttctttgagaattttatggccatagattcagagaaagagcgtattgatttt
atgtttcgcattattcagtatgtagaacgccaagtagttttatatgatagtgtagaagat
gctgcatttccaaaaatatataagcatagcaataatttagcgattaaagattattttgaa
cttgtagacaagaataaaagctgggataaaatatcagaccatctgtctaattttagtgca
cgtttagtattaaccgcacacccaacacagttctatactcctgcggttttagatattatt
gcagaattaagaactcttattttaggagataaaatagatgatatagatgttaccttacag
cagttagggcttacgtctttaattaactctaagaagccaacacctttagatgaagccaaa
aatattatttacattttacgtaatgtatattatgatgctgtaggggagctttacgcttat
ttaaaaagtaatattaataacgctgagtttgaaaattacaatatcatgaaactagggttc
tggcctgggggcgatcgtgatggtaatccatttgttacagcagatattactaatgatgtg
gcagatgaattgcgcataaccttgatgaaatgttattataatgatctgaagaaactacag
cagaaacttacgtttagcggactccaggaagatataaacaagcttagagctaatttgtat
acggcaatgtttaacccagaaaagcaggttggatatcaggatattatagggccattaacg
cagataagagcggtgttagtagaaagatatcattctttatatttagaagaattagattat
ttcattgataaagtaaaaatctttaaaacgcattttgctacgcttgatattcgtcaagat
catagcatgcatgttaaagtaattacagaaatcttaactagaaatggtttaattaaagag
aatttagatgagctttcagaaaaagaattaattgatattctattgaatgaaaagcttagt
ttaaaggtcttcgattacaatgaggaaattactcaagaaacaattaagaatattttacaa
ctaaaatctattcaagaaaagaatggagaagaagggtgtaaccgatatattataagtaat
tctgaagatatattttctgtgttatttgtatttgcattgtttagatggtgtggttggaat
gcgaaagaaatatcttttgatattgttccactttttgaaaccatgaaaggtatggaagat
tctgaagctatcatgcaacagttatttgatatgccggagtatatggcacacgtaagacaa
cgttcagaaaaacaaacgatgatgttaggtttttctgatggtactaaagatgggggctat
ttaaaagctaactggtctatcttaaaaactaaagaaagtttgtctggtgtttgtgctaag
aataatatcaaagcaattttctttgacggtcgtggtggcccaccagcgcgtggaggagga
aaaacacatcgtttttacgcagcgcagacgaaagacattgctaataatgaaatacaatta
actattcaaggacaaactattaccagtacctatggtactaaagagcagtttgtttataat
tgcgagcagcttttaacagcaggtttgtctaatagtttttatggtgatgaaaatgtcatt
actgaaaatcaaagaacgttaatagagcaactctctgaattgagttttgagaagtatgat
gcgcttaaacatcatgataaatttatgccgtacttagagaatatgagtacgcttaaatat
tatactaaagctaatattggtagtagaccagggaaacgtggtaataaagcaaaattagag
ctttcggatcttagagccatttcttttgtaggttcatggagtcagttaaagcaaaacgtt
ccaggatactttggtttaggtactgctattaaaactatgaaagataaaggcaaaatggat
gaggtgaaaaacttgtatgaaaaagtacctgtttttagagctttaatgtctaatagtatg
atggctttatccaaatgttattttgaattaacagcctacatgagagatgatgaagagtat
ggcgatttctggataattttgaaaaatgagtatgacttatctaaagaaatgcttttagaa
atttcggggatggaaattcttatggaacaagaggcactttcaagggagtctattaaaata
cgtgagaatattgtattaccgttattggttattcagcagtatgctttacagaaaattgga
gaagattctccaatgaaagaattgtatgaaaagatagtaacgcgttcgctttatggtaat
attaatgcgagtcgtaattcagcataa

DBGET integrated database retrieval system