KEGG   Cellulophaga baltica NN016038: M667_09795Help
Entry
M667_09795        CDS       T03562                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
cbal  Cellulophaga baltica NN016038
Pathway
cbal00052  Galactose metabolism
cbal00511  Other glycan degradation
cbal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    M667_09795
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    M667_09795
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    M667_09795
Enzymes [BR:cbal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     M667_09795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 Invasin_D3 BetaGal_dom4_5 Big_1 AARP2CN
Motif
Other DBs
NCBI-ProteinID: AIY13483
LinkDB All DBs
Position
complement(2285095..2287572)
Genome map
AA seq 825 aa AA seqDB search
MKALKLTPLIILFISIFISSCQENGVEVIADQEFNKDWLFLKDTVPNGEAVNLDDSNWRK
LDVPHDWAIEGPFNNKNNARNGGLPIDGIAWYRKHFTLEAKNKNKQVAIEFDGVMDNSKI
YVNGNFVGERHYGYSGFEFDITPYIKFGEDNIIAVQLAPEVLSERWYPGAGIYRNVRLKL
NEKVHIPQWGTFISTPEVTSEKATVTIKTTLKNATDKPQEIFLETTIIDASNKTMGISTE
TIEVANDSEKQLTQHMTVVNPSLWDIGKPNLYKAISRVKIKDQIVDEFETEFGIRTIEFK
KEGFFLNGKAVELNGVCMHHDLGPLGAAVNYRATERQMQIMQEMGANALRTSHNPPSPEM
LQVCDRLGIVVIDEAFDEWKEPKVPNGYSKYFDQWAEKDLRDMIKRDRNHPSVIMWSIGN
EILEQGKKDGWKIAKMLNDICHDEDDSRPTTAGFNYYPASFVNQLAAQIDVVGVNYKPAY
YGEIREQNPDMIFYGSETSSQTSTRGFYEVPQDFHVNKETNQVSSYDVTVGPPWAYAPDI
EFDAQEKNPHSLGEFIWTGFDYLGEPTPYGGRDNSTNGYWNDDWPSHASYFAPVDLVGFP
KDRFYLYQSQWTTEPMVHVLPHWNWEGKEGQTIPVYAYTNADEVELFVNGVSFGKKVKGK
DLTDVFTEYNGFKKGIYKSKYRLSWQVPYQPGSLKVVAYTNGKQVASKELKTAGKPAKIS
LVADRNTIKADGKDLSFITVRVEDEEGNLCPKSDNLIKFKVEGSGNLAAVGNGNSASLES
FQENYIKSFFGKSLAIIKGTENKGEITITATGEHLTTAILTIETE
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttaaaacttaccccattgatcattttgttcatttccatttttatatcttcc
tgccaagagaacggcgtagaagttatagccgatcaagaatttaataaagattggctattt
ttaaaagataccgtaccaaatggtgaagccgtaaatttagatgatagtaattggcgaaaa
ctagacgtacctcatgactgggctatagaaggtccttttaataataaaaataatgccaga
aatggtgggttacctattgatggtattgcatggtacagaaaacactttacccttgaagct
aaaaataaaaataagcaagtagccattgaatttgatggggtcatggataattctaaaata
tatgtaaatggaaattttgtgggtgaacgtcactatgggtatagtggttttgagtttgac
atcactccatatataaaatttggtgaagacaatattattgctgtacagcttgctcctgaa
gttttatcagaaagatggtatcctggagccggtatttatcgaaatgtacgcttaaaatta
aatgagaaagtacatatcccacaatggggaacatttatttctactccagaagttacttca
gaaaaagcaaccgtaacgattaaaacaacgttgaaaaatgctaccgataaacctcaagaa
atctttttagaaactacaattattgatgcctccaataaaactatgggcatatcaaccgaa
accatagaagtagcaaatgattctgaaaagcaattaacacaacatatgacggttgtaaac
ccaagcctttgggatattggcaagcctaatttatataaagccataagccgcgtaaaaata
aaagatcaaattgtggatgaatttgaaacggaatttggaattagaactatcgaatttaag
aaagaaggtttctttttaaatggaaaagcggtagaacttaatggcgtttgtatgcatcac
gatttaggccccttaggagccgctgtaaattacagagcaacagaacgccagatgcaaatt
atgcaagagatgggagccaatgcattacgtaccagtcacaatcctccatcaccagaaatg
ctacaagtatgtgatagattaggtattgtggttatcgacgaagcttttgatgagtggaaa
gaaccaaaagttcccaatggctatagcaaatattttgaccaatgggcagaaaaagatttg
cgtgatatgattaagagagatcgtaaccacccttctgtaattatgtggagtataggtaat
gaaatcttagaacaaggtaaaaaagacggttggaaaattgccaaaatgctgaatgatatt
tgtcatgatgaggatgattctagacccacaactgctggttttaattattacccagcttct
ttcgtaaatcaattagccgctcaaatagatgttgttggagttaattacaaaccagcatat
tatggagaaatcagggaacagaatccggatatgattttttatggatcagaaacatcgtca
caaacatctacaagaggtttttatgaagttcctcaagatttccatgtcaataaagaaacc
aaccaagtttctagttatgatgtaactgttggtccgccttgggcctatgcgccagatatt
gagtttgatgctcaagaaaaaaacccacattctttaggagaatttatatggacaggcttt
gattatttaggagaaccaacgccttatggtggtagagacaattctacgaatggttattgg
aatgatgattggccctctcatgcctcttactttgctcctgtagatctagttggttttcct
aaagaccgtttttatttataccaaagtcaatggacaaccgaacctatggttcatgtttta
ccacattggaattgggaaggcaaagaagggcaaaccatacctgtttacgcttataccaac
gcagacgaagtggagttattcgtaaacggagtatcctttggaaaaaaagtaaagggcaaa
gatctaacagacgtatttacagaatacaatggctttaaaaaaggcatttacaaatctaaa
tacagattatcatggcaggtgccttaccaacctgggagcttaaaagtggtggcgtacacc
aatggaaaacaggtagcttctaaagaactaaaaacggcaggtaaacctgctaaaatttca
ttagtagccgataggaatacaattaaggcagatggtaaagacctatcatttatcacggta
cgagtagaagacgaagagggtaatttatgccctaaatcggataatttgattaagtttaaa
gtggaaggatctggtaatttagcggcggttggaaatggaaattctgcatcactagaatct
tttcaggaaaactacatcaaatcatttttcggtaaaagtttagccattataaaaggtact
gaaaacaaaggggagattactattacggcaaccggagaacatttaactacagcaatatta
accattgaaacagagtaa

DBGET integrated database retrieval system