KEGG   Clostridiales bacterium 70B-A: PATL70BA_0751Help
Entry
PATL70BA_0751     CDS       T05737                                 

Gene name
aor
Definition
(GenBank) Tungsten-containing aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00030  Pentose phosphate pathway
cbar01100  Metabolic pathways
cbar01120  Microbial metabolism in diverse environments
cbar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PATL70BA_0751 (aor)
Enzymes [BR:cbar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     PATL70BA_0751 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: VDN46619
UniProt: A0A3P7S132
LinkDB All DBs
Position
1:complement(765926..767716)
Genome map
AA seq 596 aa AA seqDB search
MYGYQGKVLRIDLSKGVSQVEDLNLDEAKKFIGGRGLGTKLFVDEVSPSVDALSPENKIL
FATGPLTGTPTPTGGRYMVVTKSPLTGTIASSNSGGYWGAELKFSGYDVIIVEGRSEKPV
YVMIEDDQVEIRDAAHVWGKVVSETTETLLKEVPEKSRVLTIGPAGEKLSNMAAVMNDVS
RAAGRSGVGAVMGSKNLKAITVRGTNKVAIANEEALKAVVKDCNAKIRENGVTGQGLPTY
GTAVLVNIINEGGVFPTNNFQLSQFSEAEDTSGELLAEKYLTKKDPCYRCPIACGRYCKV
DDIEGGGPEYETIWAFGGDCGVSDMPSIIKSNFWCNEYGLDTISTGATIAAAMELYQKGF
IKDEDLDGLSLDFGASNAVVEWTKRIGERAGFGDKMADGSYRLADSYGVPELSMSVKKQE
LPAYDPRAIQGQGLQYATSNRGGCHVRGYLISPEILGLPEKLDRFTIEGKAAWVKIFQDF
TAFIDSSGLCLFTSFAMGAGDYAAMTNAVIGTEWTADDVLLAGERIWNLERVFNLDAGVD
PSQDTLPKRLLEDPIAEGPSKGNVARLSELLPEYYELRGWSTDGIPTQERKGLLKI
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtacggttaccaaggtaaagttctaagaattgatctaagtaaaggtgtttcacaggta
gaagatttgaatctggatgaggcaaaaaaattcatcggtggtcgcggtctaggcacgaaa
ctattcgtggatgaagtatccccatcagtggatgctttaagtccggagaataagattctt
tttgcaacaggtccattaacaggtacacctacaccaactgggggacgttatatggttgtg
accaagtcaccccttaccggtacaattgcatcatcaaactctggtggatactggggtgct
gaacttaaattctcaggttatgatgtaatcattgtagaaggtcgatcagaaaaacctgta
tatgttatgattgaagacgatcaagttgagatcagagacgcagcccatgtatggggtaag
gttgtatccgaaaccacagaaacacttttaaaagaagtacctgaaaagtccagagtcctt
acgattggaccagcaggagaaaaactttctaacatggcagcggttatgaatgacgtttct
agagcagcaggccgttcaggtgttggtgcggttatgggttccaaaaacttaaaagcaatc
actgttcgaggtacaaataaagtggccattgccaatgaagaagcgcttaaggctgtcgtc
aaagattgtaacgcaaaaatcagagaaaacggtgttaccggacaaggcttaccgacttat
ggaacagctgtccttgttaacatcatcaatgaaggcggcgtattccctacgaataacttc
caattatctcaattttccgaagcggaagataccagtggtgaactccttgctgaaaagtac
ttaaccaaaaaagacccatgttacaggtgtcccatcgcttgtggacgttattgtaaagtc
gatgatattgaaggcggcggtcctgaatatgaaaccatttgggcatttggtggtgactgt
ggtgtatcagatatgccatccatcattaaatccaacttttggtgtaatgaatatggtcta
gatacaatatcaacaggtgcgaccatagcagcagctatggaactctatcaaaaaggcttt
attaaagatgaggacttagatggtttatcattagactttggtgccagcaacgctgttgtt
gaatggaccaagcgtattggtgagagagcaggatttggcgataaaatggcagacggttct
tatcgattggcagattcttatggtgtgcctgagctatccatgtccgttaagaaacaagaa
ttgccggcttatgatccaagagccatccaaggtcaaggccttcaatatgcaacgtcaaac
cgtggtggttgtcatgtaagaggttacctcatttctcctgagattttaggtttacctgag
aaattggacagattcaccattgaaggtaaagcagcttgggttaagatcttccaagacttt
acagcttttattgattcatccgggctttgcctattcacatcctttgcaatgggtgctggt
gattatgcggctatgaccaatgcagttattggaaccgagtggacagcggatgatgtgcta
cttgctggtgaacgcatctggaatcttgaaagggtatttaaccttgatgctggtgttgat
ccttcacaagatacattacctaagcgacttcttgaagatcctattgcagaaggtccatca
aaaggtaatgtggcaagactttcagaattgttacctgaatattatgaacttcgtggttgg
agtacagatggtatccctacacaagagagaaaagggttgcttaaaatctaa

DBGET integrated database retrieval system