KEGG   Clostridiales bacterium 70B-A: PATL70BA_1899Help
Entry
PATL70BA_1899     CDS       T05737                                 

Definition
(GenBank) AP endonuclease
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
cbar  Clostridiales bacterium 70B-A
Pathway
cbar00040  Pentose and glucuronate interconversions
cbar00051  Fructose and mannose metabolism
cbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PATL70BA_1899
   00051 Fructose and mannose metabolism
    PATL70BA_1899
Enzymes [BR:cbar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PATL70BA_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: VDN47790
UniProt: A0A3P7P2Q9
LinkDB All DBs
Position
1:1906478..1907404
Genome map
AA seq 308 aa AA seqDB search
MKYATRINSFMRANKDLKMAITEIGKIRGVDYIDLNYPEHFQDYSIKEVLVMLEENDLKC
NAINLRFRDEFLNGEFGNANIEISSKAIMLCKEAVDTCKLLNGSQIIIWLGFDGFDYSFQ
MSYNKVWVQVVEAFKEICNYSSIPVSVEYKPYEERVHCLIDSFGVSMLILKEVDKENFGI
TLDFCHMLMKKENPAFAVSWLLKRNKLFNMHLNDGEGSTDDGLMVGSVHFWKTLEVFYYL
KKYDFNGVIYFDTFPKREQAKGECEANVAMCHQIDKMISQFGIEKMGQIIETNDAVSVVN
MFVAMLQK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgcgacaagaattaattcgtttatgcgcgctaataaagacctaaaaatggca
attactgaaatcggaaaaatcagaggtgttgattatatagatctgaattatccggagcat
tttcaagactattcgattaaggaagtattggtaatgctagaagaaaacgatttgaaatgt
aatgctataaatttgagatttagagatgaatttctaaatggtgaatttggaaatgccaat
attgagatctcatctaaggcaattatgttatgtaaagaagcagtggatacatgtaaactt
ctaaatggaagtcagataatcatatggttaggttttgatggttttgattattcatttcag
atgagttataacaaagtatgggtccaagttgttgaagcatttaaagagatatgtaattat
tcatcaattccggtaagtgttgaatataagccttatgaggaacgtgtacattgtttgatt
gatagctttggcgtctcaatgttgatattgaaagaagtcgacaaagaaaattttggtatt
acattggatttttgtcatatgctgatgaaaaaggaaaaccctgcttttgctgtatcatgg
ttactaaagcgtaacaaactatttaatatgcatttgaatgacggcgaaggttctacagat
gatggacttatggttggtagtgtacatttttggaagacattagaagtattttattacttg
aaaaaatacgactttaatggcgttatctattttgatacttttccaaaacgtgaacaagct
aaaggtgagtgtgaagccaatgtagccatgtgtcatcaaattgataagatgatcagtcag
tttggtattgagaaaatgggtcaaattattgaaactaatgatgcagtatctgtagtaaat
atgtttgtagcgatgttgcaaaaataa

DBGET integrated database retrieval system