KEGG   Cellulophaga baltica 18: M666_01665Help
Entry
M666_01665        CDS       T03565                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00010  Glycolysis / Gluconeogenesis
cbat00020  Citrate cycle (TCA cycle)
cbat00620  Pyruvate metabolism
cbat01100  Metabolic pathways
cbat01110  Biosynthesis of secondary metabolites
cbat01120  Microbial metabolism in diverse environments
cbat01130  Biosynthesis of antibiotics
cbat01200  Carbon metabolism
Module
cbat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M666_01665
   00020 Citrate cycle (TCA cycle)
    M666_01665
   00620 Pyruvate metabolism
    M666_01665
Enzymes [BR:cbat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M666_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H PYNP_C RnfC_N
Motif
Other DBs
NCBI-ProteinID: AIZ40402
UniProt: A0A0A7K2B2
LinkDB All DBs
Position
complement(392136..393767)
Genome map
AA seq 543 aa AA seqDB search
MAIVINMPRLSDTMEEGTVAKWLKNVGDKVEEGDILAEIETDKATMEFESFNEGTLLHIG
IQEGDGAPVDTLLAIIGEEGEDISALLNGASAPEAKAEEKQEETAAEPEPVASEASESVE
IPEGVEIIKMPRLSDTMEEGTVASWLKKVGDKVEEGDILAEIETDKATMEFESFYSGTLL
YIGTQEGESSPVDVILAIIGPEGTDVDALLASKPSTAAPKTAAAPKETATTESKAAPSAP
AETKEVVANDGQRIFVSPLAKKIASEKGVNLRDVTGSGDNGRIVKKDVENFVPAPKAAAP
AAKASGTGAPLALPVGEESVEDVKNNQMRKVIAKRLGESKFTAPHYYLNIEVDMDNAKAS
RVQINSLPDTKVSFNDMVVKACAMALRKHPQVNTSWNGDTTRYNHHISVGVAVAVEDGLV
VPVLKFTDQMGLSQIGASVRDLAGKARTKKLTPAEMEGSTFTVSNLGMFGVESFTSIINQ
PNSAILSVGAIVEKPVVKDGQIVVGNTMKLTLACDHRTVDGATGAQFLQTLRAFIENPVT
MLA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtaataaatatgccgagacttagcgataccatggaagaaggtacagtcgct
aagtggttaaaaaacgtaggcgataaagttgaagaaggtgatattttagcagaaatagaa
accgacaaagcaaccatggaatttgaatctttcaatgaaggaacattacttcatattgga
atacaagaaggagatggtgcgccagtagatactttactagctattataggtgaagaagga
gaagatatttcagcgttattaaatggcgcttctgctcccgaagctaaagcggaggaaaag
caggaggaaactgctgctgaaccagaaccagttgctagtgaagcttcagaatctgttgag
atcccagaaggggtagaaattataaaaatgcctcgcttaagtgataccatggaagaaggt
acagttgcttcttggttgaaaaaagtaggtgataaagttgaagagggtgatatccttgct
gaaatagaaacagacaaagctacgatggagtttgagtctttctattcaggaaccttatta
tatataggaacacaagaaggagaatcttctccggttgatgttattttagccattattggc
cctgaaggtacagacgttgatgcacttttagcatcaaagccatcaaccgcagctccaaaa
acagctgccgctcctaaagaaactgcaacaactgaaagcaaagcagcgccaagtgctcct
gctgaaacgaaagaagttgtagcaaacgacgggcaaagaatatttgtttctccattagct
aagaaaattgcttcagaaaaaggagtaaatttaagagacgttactggatcaggagacaat
ggaagaattgttaagaaagatgtagaaaactttgttcccgctccaaaagcagcagctcca
gcagcaaaagcttctggtacaggtgctccattagcattgccagttggtgaagaaagtgtt
gaagatgttaagaataatcaaatgcgtaaggttattgctaagcgtttgggagaatctaag
tttacagcaccacattactacctaaatatagaggtagatatggataatgcaaaagcttca
agagtacaaattaatagcttaccggatacgaaagtttctttcaatgatatggtggtaaag
gcttgtgctatggcgcttagaaagcatccacaagtaaatacctcatggaatggagataca
acacgttacaaccaccacattagtgtaggagtagcggttgctgttgaggatggtctggta
gttcctgtattgaaatttacagatcaaatgggattatctcaaattggtgcttctgttaga
gatttagccggaaaagctagaactaagaaattaacacctgccgaaatggaaggaagtaca
tttacggtgtctaacttaggaatgtttggagttgagagttttacctccatcatcaatcag
ccaaattcagcaattctttctgtaggggcaattgtagagaaaccagtagttaaagacggg
caaattgtagtgggtaataccatgaaattaacgcttgcttgtgatcatagaactgtagat
ggcgcaacaggtgctcaattcctacaaacgttacgtgcgtttattgagaatccagtgact
atgttggcttaa

DBGET integrated database retrieval system