KEGG   Cellulophaga baltica 18: M666_01695Help
Entry
M666_01695        CDS       T03565                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00564  Glycerophospholipid metabolism
cbat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M666_01695
Enzymes [BR:cbat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M666_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 Pyr_redox_2 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AIZ40407
UniProt: A0A0A7K2B7
LinkDB All DBs
Position
complement(400196..401845)
Genome map
AA seq 549 aa AA seqDB search
MEKNHFTYFKRNEIIQKLKEETFDLVVIGGGITGAGILLDASSRGMNVALVEKGDFASGT
SSKSSKLIHGGLRYLKQFELLLVKEVGTERAIVHKLAPHLVIPEKMLLPLIENGSYGEWM
TSFGLKVYDILADVEGDDKRKMMDKEKTLALEPLLPEAILKGSGYYAEYRTDDARLTLEN
IKTGLNFGGTALNYTKVNDFLYTDGQISGVKVADVVSGEEYQIKSKFVINAAGPWVDELR
TINHSKEGKQLHLTKGVHLVFEKEKLPLKQSVYFDIPDGRMMFAIPRGNVTYAGTTDTNY
ERSKDEVIATTEDADYLLNAINNMFPSVYLERKDIVSSWAGLRPLIHEEGKSPSELSRKD
EIFSSDSGLLSMAGGKLTGYRKMAERVVDKLQRRLERQTNVAYKDVFTDEIPLVGGPWKN
YKEVKKYIAKIHEILKVDNFKKHRAWYLVTTYGKQTEAILARYNASTNEKPKEKLILAEL
QFCIHNEMVVTPLDFFVRRTGRLYFDMKSVKKHREIVFSVFKETFDLNDATLQKYNSELD
ALIKSHSEF
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaatcattttacatatttcaaaagaaacgagataattcaaaaattaaaagaa
gaaacttttgatttggtagttattggtggggggattacaggggcaggtattttactagat
gcctcctcaagaggaatgaacgtggccttggtagaaaagggtgattttgcttccggaacc
agtagtaagtcatccaagctaattcatggcggactgcggtatttaaaacagtttgagctt
ttgttggtcaaagaagtgggtacagagcgtgctatagtgcataaattggcaccacattta
gtcattcctgagaaaatgctattgcctttaattgaaaatggctcctatggcgaatggatg
acttcctttgggttgaaggtgtatgatattctcgcagatgtagaaggtgatgataagcgt
aagatgatggataaggagaaaaccttagccttagagccgctacttcctgaagctatctta
aaaggttctggctattatgcagaatatagaacagacgatgctagattaaccttggagaat
attaaaacaggattaaattttggtgggacggctttaaactatacgaaggtcaatgacttt
ttgtatactgatggtcaaatttcgggagttaaagttgctgatgtagttagtggggaggaa
tatcaaattaaatctaagtttgtcatcaatgctgcaggcccttgggtagatgagttgcga
actatcaatcattctaaagaaggaaagcaattgcatttgaccaaaggcgttcatttggtg
tttgagaaagaaaaactaccgctaaaacaatcagtgtattttgatattcctgatggcagg
atgatgtttgctattcctagagggaatgtaacctatgcaggcactacagatacgaattat
gagcgctctaaagatgaagtaatcgcgactactgaagatgcagattacctcttgaatgca
attaataatatgttccctagtgtttatttagagcgtaaagatatcgtgtcttcttgggca
ggtttaaggcctttgatacatgaggaagggaagtcgccttcagaactttctagaaaagat
gaaatatttagttctgattcaggactattgagtatggcgggaggtaagcttacagggtat
cggaaaatggcagaacgggtagtagataaacttcagaggcgattagaacgacaaacaaat
gtagcatataaagatgtctttacagatgagattccgcttgttggagggccttggaagaac
tataaagaagttaagaagtatatagccaagattcatgaaattcttaaagttgataacttt
aagaagcatcgggcttggtatctagtgacaacatatgggaagcagacggaagctatctta
gcgcgctataatgctagtactaatgagaagcctaaagaaaaattaattttagcagaattg
caattttgcattcataatgaaatggtggtaactcccttagatttttttgtaagaagaaca
gggaggctctattttgatatgaagagtgtgaaaaaacatcgggaaatagttttttcagtc
ttcaaggaaacttttgatcttaatgacgccactttgcaaaagtataactccgagttagat
gcgctcataaaatcacattcagaattttaa

DBGET integrated database retrieval system