KEGG   Cellulophaga baltica 18: M666_04345Help
Entry
M666_04345        CDS       T03565                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00240  Pyrimidine metabolism
cbat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbat00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    M666_04345
Enzymes [BR:cbat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M666_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AIZ40861
UniProt: A0A0A7K472
LinkDB All DBs
Position
1045710..1046351
Genome map
AA seq 213 aa AA seqDB search
MFLENTVNPKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPQVDTRYHEEM
VVSHDANEIRSTPVPAAANIRLLADGCDVVGIDEAQFFDDEIVAVCNDLANKGIRVLVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSTNDNLVLLGEIDAYEP
LSRGAYYKAMLREKIKDIDIDVEQVKDNTNSNG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatactgtaaaccctaaagaacaatttggctggatcgaagttatctgc
ggttctatgttttctggtaagacagaggaactgatccgaaggctaaagagagcccaattt
gcgaagcaaaaagttgaaattttcaaacctcaagtcgatacacgctatcatgaggaaatg
gtagtatctcacgatgctaatgaaatacgctctactcccgtaccggcagctgctaatatt
cgtttgctagcagacggctgtgatgttgttggaattgatgaagcgcagtttttcgatgat
gaaattgttgcggtatgcaatgatttagccaacaaaggtattcgtgttttagtcgcaggt
cttgatatggattttaaaggaaacccctttggtccaatgcccgctttaatggctacggca
gaatatgttactaaggtacatgcaatatgtacgcgtacaggtaacctagccaactatagc
tttagaaaatctaccaatgataatttggtactactaggagaaatagatgcttatgagccc
ttgagtcgtggcgcatattacaaggctatgctccgtgaaaaaataaaagatattgatata
gatgtggagcaagtaaaagataataccaattctaatggctaa

DBGET integrated database retrieval system