KEGG   Cellulophaga baltica 18: M666_06765Help
Entry
M666_06765        CDS       T03565                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat03030  DNA replication
cbat03410  Base excision repair
cbat03420  Nucleotide excision repair
cbat03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    M666_06765
   03410 Base excision repair
    M666_06765
   03420 Nucleotide excision repair
    M666_06765
   03430 Mismatch repair
    M666_06765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cbat03032]
    M666_06765
   03400 DNA repair and recombination proteins [BR:cbat03400]
    M666_06765
Enzymes [BR:cbat01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     M666_06765
    6.5.1.6  DNA ligase (ATP or NAD+)
     M666_06765
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     M666_06765
DNA replication proteins [BR:cbat03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    M666_06765
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     M666_06765
DNA repair and recombination proteins [BR:cbat03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     M666_06765
   NER (nucleotide excision repair)
    Other NER factors
     M666_06765
   MMR (mismatch exicision repair)
    Other MMR factors
     M666_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AIZ41300
UniProt: A0A0A7K5J3
LinkDB All DBs
Position
complement(1594391..1596019)
Genome map
AA seq 542 aa AA seqDB search
MKNFASLIKTLDSTTKTNTKVAALAEYFAKASDTDKVWTIAILSHRRPPRPVNTTLLRQW
ASELSNIPLWLFEESYHIVGDLAETIALVIPSNPLQTDKSLTEFLEEMILLKKKSEEEKK
EYLYNNWKALDYYERFVFTKLITGGFRIGVSQKLMTKALSKATEINEDILAYKLMGNWDP
KTITFQELILEENENDYLSKPYPFYLAYAIENEVHDLGDVQEWSAEHKWDGIRSQTIFRN
DELFVWSRGEELVTDKYPELEKLVGIIPNGTVIDAEILPYANNIIGTFNDLQTRIGRKTV
SKALLKKTPVILKAYDILEWEGNDIRQLPFIERRELLEKLFQTIITIEGLPFQISETINC
STWEKVAKERERAREMHSEGLMLKRKDSPYLVGRKKGDWWKWKVDPLTIDAVLTYAMRGH
GRRSNLFTDYTFALWNTNEEGEKELVTFAKAYSGLTDAEFRKVDAWIKKNTLERFGPVRS
VTPHHVFEIAFEGIALSKRHKSGIATRFPRIIRWRHDKKIEDANTIEDLKSLIPSTSITT
TE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattttgcatcacttattaaaaccttagacagcacaaccaaaacaaatacaaag
gttgctgctctagctgagtattttgcaaaagcgagtgatacagataaggtgtggaccatc
gctatcttatcacatcgaagacctccaagaccggtaaataccaccttgttgagacaatgg
gcttcagaattatccaatatccctttatggctttttgaagagagttatcatattgtgggt
gatttagcagaaactatagccctagtaattccatccaatcctttacaaacggacaaatcg
ctcacggaatttttagaagaaatgattcttttaaaaaagaagtccgaagaagagaaaaaa
gaatacctctataacaactggaaagcattagattattatgaacgttttgtttttaccaaa
ttaattactggaggtttccgaattggtgtaagtcaaaaattaatgacaaaggccttatct
aaagctacagaaataaatgaggatatattagcctataaattgatggggaattgggatcct
aaaacaattacttttcaagaactgatattagaggaaaatgaaaatgactacctatcaaaa
ccatatcctttttatttagcttatgctattgaaaatgaagtacatgatctgggtgatgtg
caagaatggtctgcagaacataaatgggatggtatacgctcacaaaccatatttaggaat
gacgaattatttgtatggagtcgcggagaagaattagtaaccgataagtatcctgaatta
gaaaaacttgttggtattattccaaacgggaccgtcattgatgcggaaattttaccctac
gccaataacatcatcggcactttcaatgatttgcaaactaggattggaagaaaaacggtt
tctaaagcactgctaaaaaaaacacccgtaatccttaaagcctatgatattttagaatgg
gaagggaatgatattcgccaactaccatttatagaaagaagggagctattagagaaatta
tttcaaactattataactatagagggcctacctttccaaatttcagaaacaataaattgc
tccacttgggaaaaggttgcgaaagaaagggaacgggcacgagaaatgcatagtgaaggt
ttaatgctcaaaagaaaagattctccctacttggtaggtagaaaaaagggcgattggtgg
aagtggaaagtagacccactaacaattgatgccgtattaacctatgctatgcgcggacac
ggaagaagaagtaatttatttaccgattatacttttgcgctctggaatacaaacgaggaa
ggagaaaaagagctggtcacttttgcaaaagcctattccggacttacagatgcagagttc
cgtaaagtagatgcttggattaaaaagaatacacttgaacgttttggccccgtaagaagt
gttaccccacatcatgtatttgaaattgcttttgaaggaatcgctttatcaaaaaggcat
aaaagcggcattgctacgcgattccctagaattatacgctggcgacatgataaaaaaata
gaagatgccaatactattgaagatttaaaaagcttaatcccaagtacaagtattacgact
accgaataa

DBGET integrated database retrieval system