KEGG   Cellulophaga baltica 18: M666_07440Help
Entry
M666_07440        CDS       T03565                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00020  Citrate cycle (TCA cycle)
cbat00310  Lysine degradation
cbat00380  Tryptophan metabolism
cbat01100  Metabolic pathways
cbat01110  Biosynthesis of secondary metabolites
cbat01120  Microbial metabolism in diverse environments
cbat01130  Biosynthesis of antibiotics
cbat01200  Carbon metabolism
Module
cbat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cbat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cbat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M666_07440
  Amino acid metabolism
   00310 Lysine degradation
    M666_07440
   00380 Tryptophan metabolism
    M666_07440
Enzymes [BR:cbat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     M666_07440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AIZ41419
UniProt: A0A0A7K8A1
LinkDB All DBs
Position
1748899..1751688
Genome map
AA seq 929 aa AA seqDB search
MDKYSFLNAAHTSFFAELYDKYLINPDSVEPSWRAFFQGFDFGQESLLDELDLPVTPNNV
AAPSGTSEMPQSLQKEFQVIRLIDGYRSRGHLFTKTNPVRERRKYEPTLAIENFGLSSGD
LNTVFTAGEILGIGPSTLTEIISHLTNIYCDAIGVEYMYIRNPERIEWIQNWLNVNDNHP
NYDNERKKNILRKLNQAISFESFLHTKYVGQKRFSLEGNESLIPALDAIVERAAEMGVEQ
FVMGMAHRGRLNVLTNIFGKAAKDIFSEFDGKDYEQVIFDGDVKYHLGWTSDRMSDNGNK
IKMNIAPNPSHLETVGAVVEGITRAKQDAHYKDDFSKVLPIVVHGDAAIAGQGLVYEVIQ
MASLDGYKTGGTIHMVVNNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADDAEAVVH
ASLFALEYRMRFQRDVFLDLLGYRKYGHNEGDEPRFTQPKLYKAIAKHENPRDIYAAKLI
AEGIIDENYISKLEQEYKDSLETELEDSRKEDKTVITPFMADEWKGFVSVQEDEMVKPID
TSYPKEKLTQIANSLTSLPKGKKFLRKVDKLVEDRRKMFFENDSLDWAMGELLAYGSLLQ
EGFGVRMSGQDVERGTFSHRHAVVKVEDSEEEVVPLNLVEGKKGDFHIFNSHLSEYGVVG
FDYGYAMASPNTLTIWEAQFGDFSNGAQIMIDQYISAAEDKWKLQNGLVMLLPHGYEGQG
AEHSSARMERFLQLCASDNMFIADVTTPANMFHLLRRQMKANFRKPLVVFTPKSLLRHPK
AVSSIEEFATGGFQEVIDDAAADVKKVKTLVFCTGKFYYDLLAAREEHTREDVALVRVEQ
LFPLPAQKMKAIMKKYAEADDVVWAQEEPRNMGAWSHIMMHFSEASTLRVASRRFYASPA
AGSAVRSKRRHQEVIDYVFDKSKDNMIRK
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggataaatattcctttttaaacgctgcgcatacttcattttttgcagagttatatgac
aagtatttgattaatccagatagtgttgagcctagttggcgcgcattttttcaaggattt
gattttggccaagagagtcttttagatgaacttgacttgccagtaacaccaaataatgtt
gctgcaccatctggcacttcagaaatgccacaatcactacaaaaagaatttcaggttatt
cggttaatcgatggatatcgatctcgtggacatttgtttacaaaaacaaatccggttcga
gaaagaagaaaatatgagccaacgcttgctatcgaaaatttcgggttatcatctggagat
ttgaatactgtttttacagcaggggaaattttaggaatagggccaagtaccttaactgaa
attatttcgcatttaacaaacatttattgtgatgccataggtgttgaatacatgtatatc
agaaatccggaacgtattgaatggattcagaattggctaaatgtcaatgataaccaccct
aactatgataacgaacgtaagaaaaatattcttagaaaattaaaccaagccatctctttt
gagagctttttgcataccaagtatgtaggtcagaaacgattttcattagagggtaacgag
tcgcttattcctgcattggacgctattgttgagcgtgcagcagaaatgggagtagagcag
tttgttatgggtatggcgcatagaggtagactcaatgtgcttactaatatttttggtaaa
gcagctaaagatatcttcagtgagtttgatggtaaagattatgagcaagtaatttttgac
ggagatgttaaatatcacctaggttggacttcagatagaatgtctgataatggaaataaa
ataaaaatgaacattgctcctaatccatctcacttagagactgtaggagcggttgttgaa
ggtattacaagagcaaaacaagatgcgcactataaagatgatttttctaaagtgttgcct
attgttgtgcatggagatgctgccattgcaggtcagggtttagtgtatgaagtaattcaa
atggctagcttagacgggtacaaaactggaggtactatccatatggtagtaaataaccag
attggttttaccactaattatctagatgcacgtagttctacgtattgtacagatgttggt
aaagtaaccttgagtccagtattgcatgttaatgcagatgatgcagaagcggtagtacat
gcgtctttatttgctttagaatatagaatgcgttttcaacgcgatgtgtttcttgattta
ttaggataccgtaagtatggtcataatgaaggtgatgaacctcgttttacacaaccaaaa
ctttataaggcaattgctaagcatgaaaatcctagagatatttatgcggcaaaacttatc
gcagaaggtattatagatgaaaactatattagtaaattagaacaagaatataaagattct
cttgaaacagaattggaagattctcgtaaagaagataaaacagtcatcacaccttttatg
gcagatgagtggaaaggttttgtaagtgttcaagaagatgaaatggtaaagccaattgat
acttcttatccaaaagaaaaacttacgcaaatagcaaactctcttacgagcttaccaaag
ggtaaaaagtttttacgcaaagtagataagcttgtagaagatcgtagaaaaatgttcttc
gagaatgacagcttagattgggctatgggagaacttttagcctacggatctttacttcaa
gaaggctttggagttagaatgtctgggcaggatgtagaaagaggtactttttcacatcgt
catgccgttgtaaaagtagaggatagtgaagaagaggttgttcctttaaaccttgtagag
ggtaaaaaaggagattttcatatctttaactcacacctttcagagtatggagtggtaggt
tttgattatggatacgctatggcgagtcctaatacacttactatttgggaagctcagttc
ggtgattttagcaacggtgcacaaatcatgatagatcagtatatttctgctgctgaagat
aagtggaagttgcaaaacggattggtaatgttattgccgcacggttatgaaggtcaaggt
gcagaacattcttctgcgcgtatggagcgtttcttgcaactttgtgctagtgataatatg
tttatagcagatgttaccacgccggctaacatgtttcacttgttgcgtagacaaatgaag
gctaactttagaaaacctttggtagtgtttactccaaaaagtttattacgtcatccaaaa
gctgtttcttctatagaagaatttgcaacaggtggttttcaagaagtgatagacgatgct
gccgccgatgttaaaaaggtaaaaactttggtattctgtactggtaaattctattatgat
ttactggctgcacgtgaagaacatactagagaagatgtggccttagttcgtgtagaacag
ttatttcctttgccagcacagaaaatgaaggcaattatgaaaaagtatgctgaagcagat
gatgttgtttgggcacaagaggagcctagaaacatgggagcttggagtcatattatgatg
cactttagtgaagcaagtacattaagagtagcttcaagacgtttttatgcatcaccagca
gccggtagtgcagtgcgttccaaacgtcgtcatcaagaagttatagattatgtttttgat
aagtcaaaagataacatgatccgtaagtag

DBGET integrated database retrieval system