KEGG   Cellulophaga baltica 18: M666_08790Help
Entry
M666_08790        CDS       T03565                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00380  Tryptophan metabolism
cbat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    M666_08790
Enzymes [BR:cbat01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     M666_08790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AIZ41666
UniProt: A0A0A7K6E4
LinkDB All DBs
Position
2057537..2058820
Genome map
AA seq 427 aa AA seqDB search
MPFENSLAYAQQLDQQDPLRNYREEFHFPEVNGKPVIYFTGNSLGLQPKRTEAIVAEVMT
DWAKLAVEGHFYAEKPWWDYHERLAAPLAKVVGAKTAEVSVMNTLTVNLHLLMVSFYRPT
PKRFKIICEEKAFPSDQYMLTSQVKFHGFDPKDAIVEVKKRDGEHHWRTEDVVAKINEVG
DELALVLIGGVNYYNGQVFDMGTIIKAGQAVGAFVGWDLAHGAGNIELKLNEWNADFAAW
CSYKYMNSGPGNASGVYINEKHLNNPDIPRFEGWWGTKKETRFLMKPEFEPMENADAWQL
SNAPILSVAPYLASLTMFEEVGMPALIKKRDTIVAYLEYILQEIDAEVSSSFEIITPEDR
GCQLSVFLHGQGKSLFDYLMKNGVITDWREPNVIRLAPAPFYCSYEDMYRFGQLLKKGIL
ALEKENS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccatttgaaaattcgctagcctacgcgcaacaattagaccaacaagatcctttaaga
aactatagagaagaatttcattttccagaagttaatggaaagcccgtgatctactttaca
ggaaattctttaggcttacagccaaagagaacagaagctatagtagccgaagtaatgaca
gattgggcaaagttagcggtagaagggcatttttatgcggaaaagccttggtgggattac
catgagcgcttagcagcccctttggcaaaagttgttggtgcaaagacggcggaagtttcc
gtgatgaacacccttacggtaaacttgcatttgctaatggtatctttctataggcctacg
ccaaaacgttttaaaattatttgtgaagagaaggcttttccttcagatcaatatatgctt
actagtcaggtgaaatttcatggatttgatcctaaagatgctattgtcgaggtaaagaaa
agagacggagaacaccattggcgtacagaggatgttgtcgccaagattaacgaagtagga
gatgagttagccttagtgcttataggcggcgttaactattataacggacaagtttttgat
atgggaacaattataaaagcaggccaggccgttggtgcttttgtaggttgggatctggcc
catggcgctggtaatattgaactaaagcttaacgagtggaatgccgattttgccgcatgg
tgtagctataaatatatgaatagcggtccagggaatgcctccggagtatatattaatgaa
aagcacttaaataatccagatattccaagatttgaagggtggtggggaaccaaaaaagaa
acacgctttttaatgaagccggagttcgagcctatggaaaatgcagacgcatggcaatta
agtaatgctccaatattatctgtagccccgtacttagcttccctaacaatgtttgaagaa
gtagggatgccggcattaattaaaaagagagatactattgttgcttatcttgagtacata
cttcaggaaatagatgctgaggtttctagtagttttgaaataattacacccgaagaccgc
ggttgtcaattatctgttttcttacatgggcaaggtaaatctttgtttgattatttgatg
aaaaatggagtgatcacagattggagagagcctaatgtaatccgtttagcaccagcacct
ttttactgttcttatgaagacatgtatagatttgggcaattacttaaaaaaggaatctta
gctttagaaaaagaaaattcttag

DBGET integrated database retrieval system