KEGG   Cellulophaga baltica 18: M666_09030Help
Entry
M666_09030        CDS       T03565                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cbat  Cellulophaga baltica 18
Pathway
cbat00620  Pyruvate metabolism
cbat00680  Methane metabolism
cbat01100  Metabolic pathways
cbat01120  Microbial metabolism in diverse environments
cbat01200  Carbon metabolism
Module
cbat_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M666_09030
  09102 Energy metabolism
   00680 Methane metabolism
    M666_09030
Enzymes [BR:cbat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M666_09030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AIZ41709
UniProt: A0A0A7K8V7
LinkDB All DBs
Position
2106743..2109289
Genome map
AA seq 848 aa AA seqDB search
MKQVQRLEEFKKSVNNKFNVYNSLFLNLPYRNIENVGMVIPLMLDQCQKGLKSGQNPKEI
LEAFFENFMAIDSEKERIDFMFRIIQYVERQVVLYDSVEDAAFPKIYKHSNNLAIKDYFE
LVDKNKSWDKISDHLSNFSARLVLTAHPTQFYTPAVLDIIAELRTLILGDKIDDIDVTLQ
QLGLTSLINSKKPTPLDEAKNIIYILRNVYYDAVGELYAYLKSNINNAEFENYNIMKLGF
WPGGDRDGNPFVTADITNDVADELRITLMKCYYNDLKKLQQKLTFSGLQEDINKLRANLY
TAMFNPEKQVGYQDIIGPLTQIRAVLVERYHSLYLEELDYFIDKVKIFKTHFATLDIRQD
HSMHVKVITEILTRNGLIKESLDELSEKELIDILLNEKLSLKVFDYNEEITQETIKNILQ
LKSIQEKNGEEGCNRYIISNSEDIFSVLFVFALFRWCGWNAKEISFDIVPLFETMKGMED
SEAIMQQLFDMPDYMAHVRQRSEKQTMMLGFSDGTKDGGYLKANWSILKTKESLSGVCAK
NNIKAIFFDGRGGPPARGGGKTHRFYAAQTKDIANNEIQLTIQGQTITSTYGTKEQFVYN
CEQLLTAGLSNSFYGDENVITENQRTLIEQLSELSFEKYDALKHHDKFMPYLENMSTLKY
YTKANIGSRPGKRGNKAKLELSDLRAISFVGSWSQLKQNVPGYFGLGTAIKTMKDKGKME
EVKNLYEKVPVFRALMSNSMMALSKCYFELTAYMRDDEEYGDFWIILKNEYDLSKEMLLE
ISGMEILMEQEALSRESIKIRENIVLPLLVIQQYALQKIGEDSPMKELYEKIVTRSLYGN
INASRNSA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtacagcggttagaagaatttaagaagtcggtaaacaataagtttaatgtt
tacaacagtttgtttttaaacttaccataccgaaatatagaaaatgtgggtatggttatt
ccgttgatgttagaccaatgtcaaaagggattaaaatcgggacaaaatcctaaagaaatt
ttagaagctttctttgagaattttatggccatagattcagagaaagagcgtattgatttt
atgtttcgcattattcagtatgtagaacgccaagtagttttatatgatagtgtagaagat
gctgcatttccaaaaatatataagcatagcaataatttagcgattaaagattattttgaa
cttgtagacaagaataaaagctgggataaaatatcagaccatctgtctaattttagtgca
cgtttagtattaaccgcacacccaacacagttctatactcctgcggttttagatattatt
gcagaattaagaactcttattttaggagataaaatagatgatatagatgttaccttacag
cagttagggcttacgtctttaattaactctaagaagccaacacctttagatgaagccaaa
aatattatttacattttacgtaatgtatattatgatgctgtaggggagctttacgcttat
ttaaaaagtaatattaataacgctgagtttgaaaattacaatatcatgaaactagggttc
tggcctgggggcgatcgtgatggtaatccatttgttacagcagatattactaatgatgtg
gcagatgaattgcgcataaccttgatgaaatgttattataatgatctgaagaaactacag
cagaaacttacgtttagcggactccaggaagatataaacaagcttagagctaatttgtat
acggcaatgtttaacccagaaaagcaggttggatatcaggatattatagggccattaacg
cagataagagcggtgttagtagaaagatatcattctttatatttagaagaattagattat
ttcattgataaagtaaaaatctttaaaacgcattttgctacgcttgatattcgtcaagat
catagcatgcatgttaaagtaattacagaaatcttaactagaaatggtttaattaaagag
agtttagatgagctttcagaaaaagaattaattgatattctattgaatgaaaagcttagt
ttaaaggtcttcgattacaatgaggaaattactcaagaaacaattaagaatattttacaa
ctaaaatctattcaagaaaagaatggagaagaagggtgtaaccgatatattataagtaat
tctgaagatatattttctgtgttatttgtatttgcattgtttagatggtgtggttggaat
gcgaaagaaatatcttttgatattgttccactttttgaaaccatgaaaggtatggaagat
tctgaagctatcatgcaacagttatttgatatgccggactatatggcacacgtaagacaa
cgttcagaaaaacaaacgatgatgttaggtttttctgatggtactaaagatgggggctat
ttaaaagccaactggtctatcttaaagactaaagaaagtttgtctggtgtttgtgctaag
aataatatcaaagcaattttctttgacggtcgtggtggccccccagcgcgtggaggagga
aaaacacatcgtttttacgcagcgcagacgaaagacattgcgaataatgaaatacaatta
actattcaaggacaaactattaccagtacctatggtactaaagagcagtttgtttataat
tgcgagcagcttttaacagcaggtttgtctaatagtttttatggtgatgaaaacgtcatt
actgaaaatcaaagaacgttaatagagcaactctctgaattgagttttgagaagtatgat
gcgcttaaacatcatgataaatttatgccgtacttagagaatatgagtacgcttaaatat
tatactaaagctaatattggtagtagaccagggaaacgtggtaataaagcaaaattagag
ctttcggatcttagagccatttcttttgtaggttcatggagtcagttaaagcaaaacgtt
ccaggatattttggtttaggtactgctattaaaaccatgaaagacaaaggcaaaatggag
gaggtgaaaaacttgtatgaaaaagtacctgtttttagagctttaatgtctaatagtatg
atggctttatccaaatgttattttgaattaacagcctacatgagagatgatgaagagtat
ggcgatttctggataattttgaaaaatgagtatgacttatccaaagaaatgcttttagaa
atttcgggaatggaaattcttatggagcaagaagcactttcaagagagtctattaaaata
cgtgagaatatcgtattaccattattggttattcagcagtatgctttacagaaaattgga
gaagattctccaatgaaagaattgtatgaaaagatagtaacgcgttcgctttatggtaat
attaatgcgagtcgtaattcagcataa

DBGET integrated database retrieval system