KEGG   Cellulophaga baltica 18: M666_16290
Entry
M666_16290        CDS       T03565                                 

Definition
(GenBank) Iota-carrageenase
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
cbat  Cellulophaga baltica 18
Brite
KEGG Orthology (KO) [BR:cbat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    M666_16290
Enzymes [BR:cbat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     M666_16290
SSDB
Motif
Pfam: Pectate_lyase_3
Other DBs
NCBI-ProteinID: AIZ42979
UniProt: A0A0A7KCN9
LinkDB
Position
3799440..3800924
AA seq 494 aa
MKVHLKTIYVASIALLTLGCSQNYEETESQNEAEISEDLTVLKVSASQFYTPPNSAVRNN
KKNLVTDFGVNNSDTNDDSDKLNNAIRDLATNGGVLTIPRGTYYFNKIRMRSNVHLEIEK
GTVIYPTRGLVAAQNHRIFDFASKTENKIENASISGKGGKFIVDLRGNSSNNLIVADVGN
VNNFKIANMTIKDEKTVFASILISFTDKTGNAWPHNGIIENINQLDAHTGYGLIQAYAAD
NILFKNLACTGGVTLRLETDNLAMKTANKGGLNAIFASKIKNINGLTPLMFSPHFMENGK
VTVDDVTAIGCAYAVRVEHGFIEIFDKENRASGDDFKNYIEGILGAGSVEIVYRRNNGRT
WAARIANDFNERAYNHANPAVNGIKPGKFDTSNVSNVKVIYKNTGAKLKQAFLPYLPCSE
RSKVCKPGPSGFEYSGPSMGVSIDNTKRDLSLGNYNVNVSTTNVQGFPNNYILNVKHNTA
EICSGNLSTIPSCD
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaaagtacatttaaaaactatttacgtagcttctattgcgctccttacgctaggatgt
tcgcaaaattatgaagaaacagaaagccagaatgaagccgaaatttcagaagacctcact
gttttgaaagtttctgcctcccaattttacacgcctccaaattctgccgttcgcaataat
aagaagaatttagtaacggattttggggttaataattctgataccaatgatgatagtgat
aaattaaataatgctattagagatttggcgaccaatggtggtgtactcactattccaagg
ggcacatattactttaataaaattagaatgcgctctaatgtgcatttagaaattgaaaaa
gggaccgttatctatccaactagaggattagtcgctgcccaaaaccatagaatttttgat
tttgcaagtaaaactgagaacaaaattgagaatgcgagtataagtggtaaagggggcaag
tttatagtagatttaagaggaaacagctctaataatcttattgttgccgatgtaggcaat
gtcaataattttaaaatagctaatatgactattaaggatgaaaaaacggtgtttgcttcc
atattaattagttttacagacaaaaccggcaatgcttggccacataatggtattattgag
aatataaatcagctagatgcccatacgggttacggattaattcaggcctatgctgcagat
aatatcttattcaaaaatttagcctgtacaggtggtgttaccttacgtttagaaactgat
aatcttgcgatgaaaaccgcaaataaaggaggtcttaacgctatttttgcttctaaaatt
aaaaatataaatggattaacgcctttaatgttttctccacattttatggagaatggtaaa
gttacggtagatgatgttaccgccataggttgcgcatatgctgttcgcgtagagcatggt
tttattgaaatttttgacaaagaaaatagagcttccggtgacgattttaaaaattacata
gaaggaatacttggtgcgggttctgtagaaattgtttacagacgtaataatggaagaact
tgggctgcccgtattgccaatgattttaatgaaagagcctacaaccatgctaaccctgcg
gttaacggaataaaaccagggaaatttgacacttcaaacgtaagtaacgttaaggtaatt
tataaaaatactggtgctaaactaaagcaggctttcttaccctatttaccttgttcggaa
cgttcaaaagtatgcaaacccggaccttctggttttgaatattctggtccttctatgggg
gtctcgattgataatacgaaaagggatttaagtttaggaaattacaatgtaaatgtgtct
acgactaacgttcaaggctttccaaataattatatcttgaatgtaaaacacaatacagct
gaaatttgctctggcaatctttcaactataccatcttgcgactaa

DBGET integrated database retrieval system