KEGG   Clostridium botulinum B1 Okra: CLD_3461Help
Entry
CLD_3461          CDS       T00671                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cbb  Clostridium botulinum B1 Okra
Pathway
cbb00010  Glycolysis / Gluconeogenesis
cbb00053  Ascorbate and aldarate metabolism
cbb00071  Fatty acid degradation
cbb00280  Valine, leucine and isoleucine degradation
cbb00310  Lysine degradation
cbb00330  Arginine and proline metabolism
cbb00340  Histidine metabolism
cbb00380  Tryptophan metabolism
cbb00410  beta-Alanine metabolism
cbb00561  Glycerolipid metabolism
cbb00620  Pyruvate metabolism
cbb00625  Chloroalkane and chloroalkene degradation
cbb01100  Metabolic pathways
cbb01110  Biosynthesis of secondary metabolites
cbb01120  Microbial metabolism in diverse environments
cbb01130  Biosynthesis of antibiotics
Module
cbb_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cbb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLD_3461
   00053 Ascorbate and aldarate metabolism
    CLD_3461
   00620 Pyruvate metabolism
    CLD_3461
  Lipid metabolism
   00071 Fatty acid degradation
    CLD_3461
   00561 Glycerolipid metabolism
    CLD_3461
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLD_3461
   00310 Lysine degradation
    CLD_3461
   00330 Arginine and proline metabolism
    CLD_3461
   00340 Histidine metabolism
    CLD_3461
   00380 Tryptophan metabolism
    CLD_3461
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLD_3461
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CLD_3461
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLD_3461
Enzymes [BR:cbb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CLD_3461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACA43267
UniProt: B1IIH2
LinkDB All DBs
Position
1224423..1225793
Genome map
AA seq 456 aa AA seqDB search
MENIRNILEKQKSFFDKGYTKDINFRIEALKKLKHNIKINENNIFKALKIDLNKSEFETF
ITEVGIVYDEINGAIKNIKKWSKPKKVKTPITNFLASSYIYNEPYGVALIMSPWNYPFQL
IMAPLVGAISAGNCVLLKPSELAIETEKIIVKIIKDTFSDEYIGVITGGIEESTALLKEK
FDYIFYTGGINVGKIVMRAAAEHLTPITLELGGKSPCIVDKDANIDLAARRIAWGKFLNA
GQTCVAPDYLVVHRNIKEKLISSIGNYIVEFFGENTFESEDYPRIINERHFKRLEGYLKE
GKIVSGGNTDINNLYIEPTIIEGINFENRIMEEEIFGPIFPVIEFEDIDKVIDIVKNNPK
PLALYYFSENKEKQEFIIKNISFGGGCINDTIMHLSTSTLPFGGVGSSGIGGYHGRASFD
TFSHKKSILKKSNLIDIKIRYAPFKGKINLAKRLFK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggagaatataagaaatatattggaaaaacagaagagtttttttgataagggatataca
aaggatataaactttagaatagaggctttaaaaaaattaaaacataatataaaaatcaat
gaaaacaatatatttaaagctttaaagatagatttaaataaatcagaatttgaaacattt
ataacagaagtaggtattgtatatgatgaaataaatggagcaattaaaaatataaaaaaa
tggtcaaagcctaaaaaagtaaaaactccaattactaattttttagctagtagttatata
tacaatgagccttacggtgtagctttaataatgtctccctggaattatccatttcaactt
attatggctcctttagtaggagctataagtgctggtaattgtgttttgttaaagccctcc
gaattagcaatagaaacggaaaaaataatagttaaaataataaaagatacattttctgat
gaatatataggggttatcactggaggaatagaagagagtacggctttgcttaaagaaaag
tttgattatatattttatacgggtggaataaatgtaggtaaaatagttatgagagcagct
gcagagcatttaacccccataaccttagaattaggagggaaaagtccatgcattgttgac
aaggatgctaacatagatttggccgccagaagaatagcttggggaaaatttttaaatgct
ggacaaacctgtgtagcaccagattatttagtagtgcatagaaatataaaagaaaaatta
ataagttcaataggaaattatatagttgagttttttggagaaaatacctttgaaagtgaa
gattatcctagaataataaatgaaagacactttaaaagattagaaggatatttaaaggaa
ggaaaaatagtttcaggaggaaatacagatataaataatttatatatagaaccaactatt
atagaaggaataaattttgaaaatagaataatggaggaagaaatatttggccctattttc
ccagttatagaatttgaagacatagataaagttatagatatagtaaaaaataatcctaaa
ccactagcactatattatttttctgagaataaagagaaacaggaatttattattaaaaat
atatcctttggcgggggatgtataaatgatactataatgcatttgtctacttctacatta
ccctttggtggtgtaggtagcagtgggataggaggctatcatggcagagcaagttttgac
acattttctcataaaaaaagtatacttaaaaagagtaatttaatagatataaaaataaga
tatgcaccttttaaaggaaaaataaatttagcaaaaagattatttaagtaa

DBGET integrated database retrieval system