KEGG   Clostridium botulinum B1 Okra: CLD_3516Help
Entry
CLD_3516          CDS       T00671                                 

Definition
(GenBank) DNA-binding response regulator
Organism
cbb  Clostridium botulinum B1 Okra
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C OKR_DC_1_N Flagellar_put
Motif
Other DBs
NCBI-ProteinID: ACA46201
UniProt: B1IIB7
LinkDB All DBs
Position
1158126..1158827
Genome map
AA seq 233 aa AA seqDB search
MKKLFKILVVDDEERILDVVKAYLEKEDYEVITAMDGEEAIKLFKETSFHLIILDLMLPK
LSGEEVCSKIRESSNVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRKLVARVKALIR
RAYRGKYPLAEHLILNDGDLEVDIRKMKVLKNGKAVTLTPYEFKVLVSLLTNPGQVFTRE
QLVEQAFGYDYESFDRTVDTYIKNIRQKIEDNPKAPNYITTVYGVGYRFGGKN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactctttaaaatattagttgtagatgatgaagaaaggatattagatgtggta
aaagcttatttagaaaaagaagattatgaagtgataactgcaatggatggtgaggaagca
attaagttatttaaagaaacatcatttcatttaattatattggatttaatgctaccaaag
ttatctggtgaagaggtttgttcaaagataagagaatcttctaatgttccaattattatg
cttacagcaaaggtagaggaagaggataagctagaaggtctttctataggagcagatgat
tatcttacaaaaccttttagtgtaaggaaacttgtggcaagagtcaaggctcttattaga
agggcatatagaggaaagtatccattggcagagcatctaatacttaatgatggagactta
gaagttgacataagaaaaatgaaagtattaaaaaacggaaaggcggttacattaacacct
tatgagtttaaagtgcttgtttcactattaactaatccagggcaggtttttactagagaa
cagttagttgaacaagcttttggatatgattatgaaagttttgataggactgtagatact
tatataaaaaatataagacaaaagatagaagataatcctaaagctcctaactatattact
actgtatatggagttggatacagatttggaggaaaaaattaa

DBGET integrated database retrieval system