KEGG   Coxiella burnetii CbuK_Q154: CbuK_0042Help
Entry
CbuK_0042         CDS       T00788                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CbuK_0042
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cbc03400]
    CbuK_0042
Enzymes [BR:cbc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CbuK_0042
DNA repair and recombination proteins [BR:cbc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CbuK_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ACJ19369
LinkDB All DBs
Position
39025..41472
Genome map
AA seq 815 aa AA seqDB search
MILLSLKHYRQKRDFTKTSEPQGESASSSQQFIYVIQKHDASHLHYDLRLELDGVLKSWA
VPKGPSLNSDLKRLAVEVEDHPIDYATFEGNIPKGQYGAGPVIVWDKGTWQPEGNAKENL
KKGKLVFIINGEKLKGKWALVRLKTDDSKNNWLLIKKKDHYATERFDIDNYPLSVISGAS
IEEIKNHKLDLSLSDLKNAKKTVVPEFIQPQLAKLKTVVPDSPDWIHEIKFDGYRIICII
KKGIIQLMTRNQKNWTEKLAGLAETMKSIPIDESILDGEIVVFDESGKTDFQLLQNAIKA
KKYNEIKYYLFDIPFCQKFDLSQVPLIMRKRLLKKLILQWKEKSGSILYSSHIKGNGKAI
LERACELGLEGIISKKIDAAYEQRRSSSWIKLKCKRQQEFVIGGYTKPRGEQLYFGALLL
GYYQNKKLIYCGRVGTGFSSLSLKDIYEKLINREQKAPAFSELPPFGIKAGNHWVKPELV
AEIEFAEWTKDKRLRQPVFKGLREDKEAKGVKLETVKKTTVKNKSNNIKLTNPEKILYPE
EKITKRQLADFYSKIADRLLPHIVHRPLMLLRCPNGYNKECFFQKHPDQNGEEFVYSVEI
EEKERKRYLTIHDEKGLLALVQMGVLEIHPWGSSDSHPEKPDRLIFDIDPHPAVSWKAVI
NCATDVFEVLKALGLRSFVKTSGGKGLHVYVPIQPQLGWEKLHEFAQKLAKLIVQVNPRL
YTAELSKGKRLNKIFIDYIRNNRGATCVAPYSTRAKKHVPLSTPVSWDELSAVKSPTQFT
IKNIFHRLEALNQDPWEEFFDIKQSITASMWKFFS
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
gtgattctgttgagcctgaaacattatcgccaaaaacgagattttaccaaaacctccgaa
cctcagggggaaagtgcttcctctagtcaacagttcatttacgtgattcaaaaacacgat
gcttcacatttgcattacgaccttcgcttagaattagacggtgtactgaaaagctgggcg
gtccctaaagggccttccttaaattctgatctaaaacgattagctgtcgaagtggaggac
catcccatcgattacgccacttttgaaggtaatatccctaaaggacaatatggtgcgggt
ccggttattgtttgggataaaggtacctggcagcccgaagggaatgcaaaagagaattta
aaaaaaggaaagctcgtctttattattaatggtgaaaaattaaagggaaaatgggcgcta
gtaaggcttaaaaccgacgattctaagaataattggctattaattaaaaaaaaagatcat
tatgccaccgaacgttttgatatcgataattatccattaagcgtaatcagtggcgcttcc
atagaagaaattaaaaatcacaaacttgacctatcgctaagcgacttaaaaaatgcaaaa
aaaacagtagttcctgaatttatccaaccgcaactcgctaaattaaagacagttgtgccc
gattcaccggattggattcacgagattaaatttgatggctatcgaatcatttgtattatt
aaaaaaggaattattcaattaatgacacgaaatcaaaaaaactggactgaaaaattagcc
gggcttgcagaaacgatgaaatcaatacctatcgatgagtcaatactggatggagaaata
gttgttttcgatgaatcggggaaaacagatttccagcttctgcaaaatgccatcaaagcc
aagaaatacaatgaaataaaatattatctctttgatattcctttttgccagaaatttgat
cttagccaagtgccattgataatgagaaaacgattattaaaaaagttaattttacaatgg
aaagaaaaaagtggaagcatactttattccagtcatataaaaggaaatggaaaagctatt
ctagaacgtgcttgcgagttgggtttggaaggaattatttccaaaaaaatcgatgctgct
tatgagcaacgaagaagctctagttggataaagctcaagtgtaaacgacagcaagaattc
gtgattggtggctatacaaaaccgcggggagaacaactctattttggcgctttattatta
ggctattatcaaaataaaaaattaatttattgtgggagggttggcactgggtttagcagt
ctatcgttaaaagatatttatgaaaaattaataaatcgcgaacaaaaagcccccgccttt
tctgagttacctccttttggaataaaagcaggcaatcattgggtaaaacccgaattagtg
gctgagattgaattcgctgagtggacgaaagataaacgtttgaggcagccggtttttaaa
gggttgcgtgaagacaaggaagctaaaggagttaaattagaaacagttaaaaaaacgaca
gtcaaaaataagtctaataatattaaattaaccaaccctgaaaaaattctataccccgaa
gaaaaaatcacgaaacgccagttggcggatttttatagcaaaatagccgatcgcttactg
cctcacatcgttcaccgcccgttgatgctgcttcgttgtccgaatggctataacaaagaa
tgtttttttcaaaaacatcctgatcaaaatggcgaggaatttgtttatagcgttgaaata
gaagaaaaagagagaaaaaggtatctgacgattcatgatgaaaaaggccttcttgcatta
gttcaaatgggcgtcttggaaattcacccgtggggcagcagcgattcgcatccggaaaaa
ccagaccgattaatttttgatattgatccgcatccggcggtcagttggaaagccgtgatt
aattgcgcgactgatgtttttgaagtattgaaggctttgggtttgcgaagttttgttaag
acttctggaggaaaagggttgcacgtgtacgttcctattcagccgcaattgggttgggag
aaactgcatgaattcgcgcagaagttggctaaattaattgttcaggttaatccacgtctt
tatacagctgaattgagtaaaggaaaacggctcaataaaatatttatcgattatattcga
aataaccgaggcgccacttgtgtggcgccttatagcacccgagcaaaaaagcatgtccct
ctttccaccccggtttcctgggatgaattgtcagcggtaaaatcccctacccaatttacg
ataaaaaatatattccatcgcctggaggcattaaaccaagacccttgggaggagtttttc
gacataaaacaatcaatcactgcctcgatgtggaaattttttagttaa

DBGET integrated database retrieval system