KEGG   Coxiella burnetii CbuK_Q154: CbuK_0520
Entry
CbuK_0520         CDS       T00788                                 

Gene name
icmH
Definition
(GenBank) IcmH
Organism
cbc  Coxiella burnetii CbuK_Q154
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ACJ19800
LinkDB
Position
complement(468990..469763)
AA seq 257 aa
MTKEIFTNSPLETVRDGKAHSVFDASIAINPLVAACAPLLTIATQLRDQEQSPNLPKLYE
SLSSEIKLFEEKAHSLGYRSPVILAARYFLCALIDEIILHSPWGENSEWQRLGLLKTFQD
ESWGGERFFIILERSAEDADLHIDLLELGYLCLSLGYKGKYNEKNYQELEPLVDKLYYLI
REERGESSNRLFISSAEKPVPKNWISRLPSVWATLGVTALVLIGIYLPYHFRLEKVASPI
RQTLKNMTPATISKAIS
NT seq 774 nt   +upstreamnt  +downstreamnt
atgacaaaagaaatcttcacaaactcccctcttgagactgtaagagacggaaaggcacac
agtgtctttgacgcctctatcgcgattaatcctctggtagcagcttgtgcacctttgctc
accattgcaacgcaattacgtgatcaagagcagtcgcctaacttgcctaaactttacgaa
tctctatcctcggaaataaagctctttgaagaaaaagcccattccttaggttaccgatca
cccgtcattttagcggcacgttattttctttgtgcgttaatcgatgaaattattctgcat
tccccgtggggggaaaacagcgaatggcagcgtctgggattattgaaaaccttccaggat
gaatcctggggcggcgaacgtttctttattattctcgaacgaagcgccgaagacgccgat
cttcatattgatcttttagaattaggctatctttgtttgagtttaggatataaaggaaaa
tataacgagaaaaattaccaagagctggagccgcttgttgataagctgtattatttaatt
cgtgaggaacgcggcgaatcctccaatcgtttgtttatttctagcgctgagaaacccgtt
cccaaaaattggatttctcgattaccctcggtatgggcaacgcttggcgtaacagcgctt
gttttaatcggcatctatttgccgtatcatttccgccttgaaaaagtggcatcgcccatc
cggcaaactttaaaaaatatgactccggctactattagtaaagcgatatcatga

DBGET integrated database retrieval system