KEGG   Coxiella burnetii CbuK_Q154: CbuK_1122Help
Entry
CbuK_1122         CDS       T00788                                 

Definition
(GenBank) D-alanyl-D-alanine serine-type carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00550  Peptidoglycan biosynthesis
cbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CbuK_1122
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cbc01002]
    CbuK_1122
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbc01011]
    CbuK_1122
Enzymes [BR:cbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CbuK_1122
Peptidases [BR:cbc01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CbuK_1122
Peptidoglycan biosynthesis and degradation proteins [BR:cbc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CbuK_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ACJ20317
LinkDB All DBs
Position
1079757..1081013
Genome map
AA seq 418 aa AA seqDB search
MKFLHSRLSAVFLATILLFSVGFSVSALGDVENAAQQNLALAKAATQQQPETPPSLVPPP
PNLDVKGYVLMDADSGIVIAQKNMTQRLQPASLTKLMTLYVTFQALKSAQIHLDDKAKVS
VKAWRTGGSRMFLKEGAEVPVNLLIQGIIVASGNDACVTMAQYIGGTEPSFAQMMNQTAA
RLGMKNSHYVDSTGLPRPDHYSTPYDMAALTRAIINDFPEYYHYFSQKWLTYNNIKQPNR
NRLLWRDGSADGLKTGHTEEAGYCLIASAKRNNMRLISVVMGAPTDSERADDSEALLNYG
FRFYQTRQLFDANTSITKKRIWMGKRKHAEFGLTQPLYVTLPVGEDKNLKATMSFAIQHL
QAPILKGQSYGEINVILNGKPIKKVPLIALQDDPRAGLFSRAWDHLALFFEGIFSKSS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttacattcccggctatcagctgttttccttgccactattttacttttttct
gtgggattttcagttagcgctcttggcgatgtcgagaatgccgcccaacagaatcttgct
ctcgcaaaagccgccactcagcaacaacctgagacgccgccttcgttagttcctcctcca
cccaacttggatgtcaaagggtatgtgttaatggatgccgattccggtattgtcattgct
caaaaaaatatgactcagcgccttcaaccggcaagcttaacgaaactaatgacactgtat
gtcacctttcaagcgctaaagagcgctcagattcatttagacgataaagcaaaggtcagc
gttaaagcctggcgcacaggtggctctcgaatgtttttaaaggaaggcgctgaagtccct
gtcaacttattaatccaagggatcattgtggcttcggggaacgatgcctgcgtcaccatg
gcgcaatatattggcgggacagaaccctctttcgcccaaatgatgaatcaaacggcagcg
cgactaggaatgaaaaattcacattatgtcgattctaccggtttgcctcgtccagaccat
tattcaacgccttacgatatggccgctctaacccgcgctattatcaatgactttccggaa
tattatcactacttctcccaaaaatggctgacttataacaatatcaagcaacccaatcgc
aatcgcttattgtggcgtgatggttcagccgatggcttaaaaacaggtcatacggaagaa
gccggctattgtttgattgcctcggccaagcgcaataacatgcgtttaatttcggtagtt
atgggagcgccaaccgacagcgagcgagcggatgattctgaagcgttgttaaattatgga
tttcgtttttaccaaacgcgccaattattcgatgctaatacctcaattactaaaaaacgc
atttggatgggcaaacgaaaacacgccgaatttggtttaactcaaccgctctatgttacg
cttcccgtgggtgaggataaaaatttaaaagcgacgatgagttttgccatccagcatttg
caggcgcctattttgaaaggacagtcttatggcgaaattaatgtgatcttaaatggaaaa
cccattaaaaaagttcccttaattgctttgcaagatgatcctcgcgctggtttattttcg
cgtgcttgggatcatctcgcactattttttgagggaatttttagcaaatcgtcatga

DBGET integrated database retrieval system