KEGG   Coxiella burnetii CbuK_Q154: CbuK_1288Help
Entry
CbuK_1288         CDS       T00788                                 

Gene name
pbpA
Definition
(GenBank) cell elongation specific D,D-transpeptidase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
cbc  Coxiella burnetii CbuK_Q154
Pathway
cbc00550  Peptidoglycan biosynthesis
cbc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cbc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CbuK_1288 (pbpA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CbuK_1288 (pbpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cbc01011]
    CbuK_1288 (pbpA)
Enzymes [BR:cbc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CbuK_1288 (pbpA)
Peptidoglycan biosynthesis and degradation proteins [BR:cbc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CbuK_1288 (pbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACJ20470
LinkDB All DBs
Position
1245090..1247006
Genome map
AA seq 638 aa AA seqDB search
MIGMNRERLTIKNIHLETHLFKSRCLTALILLLIFAFILIGRLIYLQIKNHHFYSTLSRH
NLLNIIPIEPNRGLIFDRNGVLLAKDIPTYILTILPNGTHHLNETIRELTKIIPISSDEI
KQFHHILYQYHRYQPVPLKYKLTNEEVARFYVNQYRFPDVRIETRMMRYYPLGDVTSDVV
GYVGRINARELQKVNTNNYNIDDDIGKMGIEKYYENELHGTMGAEEAEINASGRIVRILK
RVPPTPGTNIYLTIDSNLQAEARKVLGEESGAIVAIQPSTGQVLALVTKPSFDPNPFVSG
LSQQDYQKLVNSPQHPLYNRAIRGQFASGSTVKPFLALFGLDMGIITPQYRIYDPGWFQL
PNTQHIYHDWRERGHGWVNVVKAIAVSCDVYFYNLAVALGIKRMDDILQRFGFGQLTGID
LPEEVPGLVPSPRWKMGTQGKPWYTGDTIEAGIGQGFFLVTPLQLAQATATLAEHGKRYR
PTLLFKSVEPTGKVNVQQPIPKPPIFLKNPDNWDIVIHAMQEVVDKPWGTAGFFGRHPGF
TVAAKTGTAQVYGHQRDEDKSRTNIPKRLRNNHLFIAFAAVENPQIAVAVVVEHSAMADK
MAGEIINYYFKHQQKIISLLFRREKGKRGYIDNTRSSA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcatgaatagagaacggctgacgattaaaaacattcatcttgaaacacacttg
ttcaaaagtcgctgcttgactgcccttattctccttttgatttttgcctttatcctcatc
ggaaggttaatttaccttcagatcaaaaatcaccatttttattccaccctttcacgccac
aatctattaaatattattcccattgaaccgaaccgcggtttgatatttgatcgaaatggc
gtgttgttagccaaggatatcccgacttacatcttaaccatcctccccaatgggacccat
cacttaaacgaaaccataagagaacttactaaaataattcccatttcctccgatgagatt
aaacaatttcatcatatcctctatcaatatcaccgctaccagcccgtcccattaaaatat
aaattaacaaacgaagaggttgcccgtttttatgtaaaccaatatcgatttcccgacgtg
cggattgaaacgcgaatgatgcgttattacccgctcggggacgtcaccagcgatgtagtg
ggatacgttggtcgaattaatgcccgagaactgcaaaaggtaaacaccaacaattacaac
atcgatgacgatatcggcaaaatggggatcgaaaaatattatgaaaacgaactccacggc
acaatgggcgctgaagaggctgaaatcaatgccagtggacggatcgttcgtatattaaaa
agggtaccgcctacaccgggaactaacatctatctcactattgatagcaaccttcaggcc
gaagcgagaaaagtcctgggtgaggagagcggtgccatcgttgccatccaacccagcaca
ggacaggtcttggcgttggttaccaagccaagctttgatcccaaccccttcgtctctggc
ttgagccaacaagactatcaaaaattagtaaactcgccacagcaccccctctacaatcga
gcgatccgcgggcaatttgcctcgggctcaacggttaaaccttttttagcgcttttcggt
ttggatatgggaattatcaccccacaataccgaatttacgatccggggtggttccaatta
cccaacacccaacatatttatcacgattggcgagaacggggacacggctgggttaacgtc
gtcaaagcgatcgcggtctcttgtgatgtttacttctacaatctagcagtggcgctgggt
attaaacggatggacgatattcttcagcgctttgggtttggccaactaacggggatcgat
ttaccggaagaggtccctgggcttgttccctccccgcgctggaaaatggggacgcaaggc
aaaccttggtataccggcgataccattgaggccggcattggtcagggatttttcctagtt
acccctttgcagctcgcacaagcgacagcgactcttgccgaacacggcaaacgctatcgg
cccacgctgttattcaagagtgtggaacccacgggaaaagtcaacgtccaacagccgatc
cccaaaccccccatttttttgaagaaccctgataattgggatattgttatccatgcgatg
caagaggtggtggataagccgtggggaacagctggtttctttggcagacatcctggtttc
acggtagcggccaaaaccggcaccgcccaggtctacgggcaccagcgcgacgaagataaa
agccgcaccaatattcccaagcgcttacgcaacaaccacctttttattgcttttgcggcg
gtcgagaacccgcaaatagccgttgcagtagtggttgaacatagcgcaatggctgataaa
atggcaggagaaatcattaattattacttcaaacatcagcaaaaaataatttcccttctt
tttcgtagggagaaaggtaaaagaggttatattgacaacacgcgctcatctgcttaa

DBGET integrated database retrieval system