KEGG   Coxiella burnetii Dugway 5J108-111: CBUD_1524Help
Entry
CBUD_1524         CDS       T00583                                 

Gene name
smc
Definition
(GenBank) chromosome partition protein smc
  KO
K03529  chromosome segregation protein
Organism
cbd  Coxiella burnetii Dugway 5J108-111
Brite
KEGG Orthology (KO) [BR:cbd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cbd03036]
    CBUD_1524 (smc)
Chromosome and associated proteins [BR:cbd03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    CBUD_1524 (smc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_23 AAA_21 SMC_hinge AAA_29 Spc7 SlyX ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABS78106
UniProt: A9KCS2
LinkDB All DBs
Position
complement(1521684..1525193)
Genome map
AA seq 1169 aa AA seqDB search
MYLKTIKLAGFKSFVDPTLIPIRGSMNAIVGPNGCGKSNVVDAVRWVIGETSAKQLRGQS
MSDVIFNGTTSRKPVGKASIELHFDNSEGRIGGEYAKYGEIAIRREVERDGQSNYFINGA
HVRRRDVVDVFLGTGLGSRSYAIVEQGMISNLIEAKPEELRVYIEEAAGISKYKERRRET
ESRMRHTQENLDRVNDIAEELAKQLRHLKRQANAAERYKAYKQEERVLGAQFKVLQWKAL
DHKLSEHDQAINQKNTRREEKQSEQHRIETEIEKMREQLTDVNEKHNAVQKRYYGLGADI
ARLEQRIKDTQEKIHQWQSELEENENVWEELQNNTAECEAQITELETELEHLKPRSSDIH
SAAAEASKELAQAESNMARWQEAWEAFQAETSQTMSQLEVMRTKREHCERQLTDLEKRKQ
QLQQNLKQLQLDQLLNEIAPLSSQSELLNAELSDSQSKLQSLAETIASRRDANQTTREEL
QTQRRELQALEARAASLEALQKAALGESDGKISEWLSSQQLKENPRLGQKLVVNPGWEIA
VETVLSGFFDAVCVDAALPFLTDLTTVSEGRVTLVEKKSVSASAFDKAPTLASQVKSEWP
FQQWLAGIYIADTLDQAKQLQSSLQENESVITKEGLWLGPHWARISKLQDAPQSGFLLRE
QQLKQLKANILGQQKKCDEQEALLKSGEQQLNQLETDRDTLLQTYQKLNAEATTVQSALS
TKQAQLDNAQQQQTRLKIGLNECEQQIKQCQQQLTLIKNKASSLDDSQGLLATRREEMIR
ERDHYRTQLIELREKAHQKRKEADELEIRLASNEDQLSLLRQTVARYQRQLKQLTERREM
LSQYLSEGDKPLEELNEKLQTQLEQRLILETELREVEKELEEANQLLRHLEEKRVSTQKA
LNEAQAQLEELRMQRQTVSVRQTTIKEQLSENDFDLEKVMAELPEEATIESWQEKLDQLV
ERIQRMGPINLAAIEEYESVNERKNYLDKQHADLTEALEILKNAIHKIDRETRAKFQETY
DQVNQQFQSLFPRIFGGGRATLEMTDTDLLTAGVIVRAQPPGKRNVTIHMLSGGEKALTA
VALVFSLFQLNPAPFCILDEVDAPLDDINVGRFCQLVQEMSKEVQFLVISHNKVTIEMAD
YLMGVTMQEPGVSRIVSVNMQEAIGLVEA
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaaagaccatcaaacttgctggattcaaatcatttgttgatcctacgcttatc
cccattcgcggttcgatgaacgccatcgttggccctaatggctgcggtaaatcaaatgtg
gttgatgcagtgcgctgggtaattggagaaacctcggcaaaacagttgcgcgggcagtcg
atgagcgatgtgatattcaacggcaccacctcccgtaaacccgtcggtaaagcctccatt
gaacttcattttgataacagtgaaggccgaattggcggcgagtacgccaaatacggcgag
atcgctattcgccgcgaagtcgagcgcgatgggcaatcgaattattttatcaacggcgcg
cacgtacgccggcgtgatgtcgtggatgtctttttgggcacagggcttggatcgcgtagt
tatgccatcgtggaacaagggatgatttctaatctcatcgaagcaaagccagaagaattg
cgggtttacatcgaagaagctgccggtatttcaaaatacaaagaacgccgccgcgaaacc
gaaagccgaatgcgccatacacaagaaaacttagatcgggtcaacgatattgctgaagaa
ctggctaaacaactgcggcatttaaaacgtcaggccaacgcggcggaacgttataaagct
tataagcaagaagaacgcgtgcttggcgctcaattcaaagttttacaatggaaggcgcta
gaccataaattatctgaacatgatcaagctattaatcagaaaaatacccgccgagaagaa
aaacagagcgagcaacatcgcattgaaaccgaaatagaaaaaatgcgggagcaattaacc
gatgttaatgagaaacataatgctgtgcaaaaacgttattatggtttaggcgctgatatt
gcccgtttagagcagcgtattaaagacacgcaagaaaaaattcaccaatggcaatccgaa
ttagaagaaaatgaaaatgtatgggaggaactgcaaaataatacggctgaatgcgaagcg
caaataacggaattagaaaccgagttagagcatttaaagcctcgatcgtctgatattcat
tcagctgccgccgaagcttccaaggaattggcgcaagcggaatcgaacatggcccgatgg
caagaagcttgggaagcttttcaagcagaaacttcgcaaaccatgagtcagctagaagtc
atgcgaaccaaaagagagcattgcgaacgtcaattaacggatttagaaaaacgcaaacag
caattgcaacaaaatttaaagcaattacaactcgatcaacttttaaatgaaatcgcgccc
ttatcctcacagtccgaattattaaacgcggaactcagcgatagccagtcgaaattacaa
tcattagctgaaacaattgcttctcgccgtgatgcgaatcaaactacacgggaggaatta
caaacccaacgacgcgaactgcaagctttggaagcccgcgcagcttcattagaagcgttg
caaaaagcggccttaggagagagtgacggaaaaatcagtgaatggctttcttcccagcag
ttaaaagaaaatccgcgcctggggcaaaaattagttgtcaatcccggttgggagatagca
gttgaaacagtattaagcggcttttttgacgcggtttgtgtggatgcagcgctgccattt
ctgactgatttgacgacggtgtcagaaggccgggttacactagtagaaaaaaaatcggtt
tctgccagcgcttttgacaaagcgcctacattggccagtcaagtcaaaagtgagtggcct
tttcaacaatggttagcgggaatttatatcgccgacacactggaccaagcaaaacaattg
caaagttcattgcaagagaatgagtctgtgattaccaaagaaggcctttggcttggtccc
cattgggcacgaatttcgaaactacaagacgcaccgcaaagcggatttttactgcgggaa
caacaattaaaacaattaaaagcgaatattcttggacagcaaaaaaaatgcgacgagcag
gaagcgttattaaaatcgggtgaacaacaattaaatcagctcgaaactgaccgcgatacg
ttgctccagacttatcagaagttaaacgcagaagcaacgactgttcaaagcgcgttaagc
actaaacaagcgcaattggataatgcacaacaacaacaaactcgtttaaaaataggtctt
aacgaatgtgaacagcagattaaacaatgccaacaacaattaacgcttataaaaaataaa
gcgtcttcgttagacgattcacaaggcttattagccacgcggcgcgaagaaatgatacgg
gaacgagatcattatcgcacccaattaatcgaattacgtgaaaaagcccatcaaaaacgc
aaagaagccgatgagttggagattcgattggccagcaacgaagatcagctatctctgtta
agacaaacggttgcgcgatatcaacggcaattaaagcagcttaccgaacggcgcgaaatg
ttgtctcaatatttatcggaaggtgataagcctttagaagagttaaacgagaaattacaa
acgcaattggaacaacgacttattttggaaacggagctacgagaagtcgaaaaagaactc
gaagaggccaatcaattattacgtcaccttgaagaaaaacgcgtttcgacgcagaaagcg
cttaatgaagcgcaagcgcaattagaagaattgcgtatgcagcgccaaaccgtcagtgta
agacaaaccactattaaagaacagctaagcgaaaatgattttgatcttgagaaagtcatg
gctgaattgccagaagaagcgacgatcgaaagttggcaagaaaaattagatcagctcgtc
gaacgtattcaacggatgggaccaatcaatttggccgctattgaagaatacgaaagcgtg
aatgaacgaaaaaattatttagataaacaacatgccgatttaaccgaagcgctggaaatt
ttaaaaaacgcaatccataaaatcgatcgtgaaacacgcgctaaatttcaagaaacctat
gatcaggtcaatcaacaatttcaatccttatttccacgcattttcggtggcggccgggca
accctcgaaatgacagatactgatttattgacggccggcgtaatcgtgcgcgcccaaccg
cccggaaagcgcaacgtcactatccatatgctatcaggcggtgaaaaagcgctgacggcc
gttgcgttggttttttccttattccaattaaatccagcgcctttttgtattttggacgaa
gtggatgccccccttgatgatattaatgtcggtcgtttctgccaacttgttcaagaaatg
tctaaagaggttcaatttctagtaattagccataacaaggtgactattgaaatggctgat
tatttaatgggtgttacaatgcaagagcctggcgtctcgcgaattgtctcagtcaatatg
caagaagctatcgggttggtggaagcataa

DBGET integrated database retrieval system