KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_0729Help
Entry
Cbei_0729         CDS       T00547                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
cbe  Clostridium beijerinckii NCIMB 8052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh NinE
Motif
Other DBs
NCBI-ProteinID: ABR32913
UniProt: A6LRD3
LinkDB All DBs
Position
875799..877280
Genome map
AA seq 493 aa AA seqDB search
MNVKLENRYRLFINGEWRDASDGTTIKTYNPANGEFLAEIADATEKDVDDAVNSARQAFA
TWGKTTVVERANILNKIADIIEENAEYLATVETLDNGKPIRETTGADIPLAADHFRYFAG
VIRADEGSATMIDENTLNLILSEPIGVVGQIVPWNFPFLMAAWKLAPVLAAGDVSVFKPS
STTSLSVLELMKLIQNIVPSGVINVITGKGSKSGEYLQNHEGLDKLAFTGSTEVGRQIGL
AAAKRIIPATLELGGKSANIFFSDANMNIALEGIQLGILFNQGQVCSAGSRIFVQEDFYD
EFMEKAIAAFEKVKVGNPLDPNTQMGAQVSESQLKKILKYIEIGKKEGAKVATGGERFIE
GDAKNGYFMKPTLLTDVTNDMRIAREEIFGPVGVVIKFKTEEEVIAMANDSEYGLGGGVF
TTNLNRAIRVAKEIRTGRIWVNTYNTFPAGATFGGYKESGIGRETHKVILEAYTQKKNII
VNLSETPGGMYIK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttaaattagaaaatagatatagattatttattaatggagaatggagagatgct
tcagatggaactacaataaagacttataatccagctaatggggaatttttagctgagatt
gcagatgctacagaaaaagatgtagatgatgctgttaattctgcaagacaagcctttgct
acatggggcaaaactactgttgtagaaagagcaaatatattaaataaaattgctgatatt
attgaagaaaacgcagaatacttagctacagtagaaactttagataatggaaaaccaatt
agagagacaacaggagcagatattccattagcagcagatcactttagatattttgcaggt
gttattcgtgctgatgagggttctgcaacaatgatagatgaaaatactttaaatttaata
ttaagtgagccaattggtgttgtagggcaaatagttccttggaattttccattcttaatg
gcggcttggaagttagctccagtgttagcagctggggatgtttcagtatttaagccatca
agtactacttcattaagcgtattagagcttatgaaactaatacaaaatattgttcctagt
ggtgtaattaatgttattacaggaaaaggatcaaagagcggtgaatatctgcaaaatcat
gaaggacttgataaattagcatttacaggatctacagaagttggaagacaaattggactt
gctgcggctaaacgtattattcctgcaactttagagcttggaggaaagtcagctaatatt
ttctttagtgatgcaaatatgaacattgcattagaaggtattcaattgggaattttattt
aaccaaggacaagtttgttctgcaggttctagaatatttgtacaagaagatttttatgat
gaatttatggaaaaagcaattgctgcttttgaaaaagtcaaagttggaaacccattagat
cctaatactcaaatgggagcgcaagttagtgaatctcaacttaaaaaaattcttaaatat
atagaaataggtaaaaaagaaggcgcaaaagtagcgacaggaggggaaagattcattgag
ggtgatgctaagaatggatactttatgaaacctactttacttacagatgttactaatgat
atgagaatagctagagaagaaatatttgggccagttggagttgtaattaaatttaagaca
gaagaagaagtcattgctatggcaaatgatagtgaatatggtttaggtggtggagtattt
actactaacttaaatcgtgctataagagttgctaaagaaataaggactggacgtatatgg
gttaacacttataatactttcccagcaggtgcaacatttggtggatacaaagaatctggt
ataggcagggaaactcacaaagttatattagaagcgtatactcaaaagaaaaatatcata
gttaatttatcagaaactcctggtggaatgtatataaagtaa

DBGET integrated database retrieval system