KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_2128Help
Entry
Cbei_2128         CDS       T00547                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Pathway
cbe00970  Aminoacyl-tRNA biosynthesis
cbe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cbei_2128
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cbe03029]
    Cbei_2128
Enzymes [BR:cbe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cbei_2128
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cbei_2128
Mitochondrial biogenesis [BR:cbe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cbei_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABR34295
UniProt: A6LVB5
LinkDB All DBs
Position
2480258..2481697
Genome map
AA seq 479 aa AA seqDB search
MQMNIKEMVEKIKSRELTSEALVQSYIEEITKNESTINAFLTLTCEEALAKAKEIDAKVK
AGESLGRLAGIPIAIKDNICTEGVNTTCASKMLEDFIPPYDATVIKKLLAEDAIIIGKTN
MDEFAMGSSNENSAFKKTLNPRDTTRVPGGSSGGSAAAVAAKFAPVSLGSDTGGSIRQPA
AFCGVVGLKPTYGLVSRFGLIAFGSSLDQIGPFSNSVEDSAYILNIISGTDEYDSTSIRD
LKEIDYTASLQDGIKGMKIGVPEEFFGEGLDEEIKESVKNSLEKLKELGAEVETFSLPII
KDGLAAYYIMSSAEASTNLDRYDGIRYGYKTPNYTNLDELVENSRTEGFGAEVKRRIMLG
TYALASGYYDAYYKKADAFRRKLRYDLKKTFEKYDLIVGPVSPVLPFKIGEKKADPLSMY
LADIYTINVNLAGNPAISIPAGKSKEGLPIGIQLMGDMLCEEKIFKAAYSLEQALAIEL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaatattaaagaaatggtagaaaaaattaaaagtagagaattaactagtgaa
gcactagttcaatcatatattgaagaaattacaaaaaacgagtcaactataaatgcattt
ttaacacttacttgtgaggaagcgttagcaaaagctaaagaaatagatgctaaagtaaaa
gccggtgaatctctaggaagacttgcaggtattccaatagcaataaaggataatatttgt
acagaaggagtaaacactacttgtgcatcaaaaatgcttgaagattttattccaccatat
gatgcaactgtaataaaaaaattattagctgaagatgcaataattattggtaagacaaat
atggatgaatttgcaatgggatcttcaaatgagaactcagcatttaaaaagactttaaat
ccaagggatacaactagagttccaggaggatcatcaggtggatcagcagcagcagttgca
gcaaaattcgcaccagtgtcgttaggatctgatacaggtggatctataagacagccagca
gcattttgcggtgttgtaggattaaaacctacatatggattagtttctagatttggactt
attgcttttggttcatcattagatcaaattggaccattttctaattcagtagaagacagt
gcctatattttaaatataatttctggaactgatgaatatgattctacaagtataagagat
ttaaaagaaatagattatactgctagtcttcaagatggaattaagggaatgaaaatcggt
gtccctgaagaattctttggtgaaggtttagatgaagaaattaaggaatcagtaaaaaat
agtttggaaaaattaaaagaattaggagcagaagttgaaacattttctcttcctataatt
aaagacggattagcagcttattatataatgtcatctgctgaagcaagtactaatttagat
agatatgatggaataagatatggttacaaaactccaaattacacaaatctagatgaatta
gttgaaaacagtagaactgaaggttttggagcagaagttaagagaagaataatgcttgga
acatatgcacttgcttctggatattatgatgcttattataagaaagcagatgcttttaga
agaaaattaagatatgatcttaaaaagacttttgaaaaatatgacttaatagtaggacca
gtttcacctgtattaccttttaaaattggtgaaaaaaaggctgatccattatcaatgtac
ttagctgacatttacactattaatgttaatttagctggaaatccagcaatatcaattcca
gcaggaaagagcaaagaaggcttaccaattggaattcaattgatgggtgatatgttatgc
gaagaaaaaatattcaaagctgcatatagcttagagcaagctttagctattgaattatag

DBGET integrated database retrieval system