KEGG   Clostridium beijerinckii NCIMB 8052: Cbei_2134Help
Entry
Cbei_2134         CDS       T00547                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbe  Clostridium beijerinckii NCIMB 8052
Brite
KEGG Orthology (KO) [BR:cbe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cbei_2134
Enzymes [BR:cbe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cbei_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored FAD_binding_3 Thi4 AlaDh_PNT_C NAD_binding_8 NAD_binding_7 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: ABR34301
UniProt: A6LVC1
LinkDB All DBs
Position
complement(2488814..2490343)
Genome map
AA seq 509 aa AA seqDB search
MILDKDIKQQLAQYLELMEGTVLIKVSADSDDISNTMVSLVDELVSMSPKIKAEKSKLLR
TPSFSINRTDEETGVAFAGIPLGHEFNSLVLALLQVSGRAPKIDQKTIDSIKNIKGEYHF
ETYISLSCHNCPEVVQSLNLISILNPKVTHTMIDGAVFKEEIESKNILAVPSVYLNGEFF
ASGRMTIEEILAKIGEAPVSENFADKDPYDMLVVGGGPAGASAAIYAARKGIRTGIIVER
FGGQVLDTIGIENFISIKYTEGPKLAASLEEHVKDYNVDIVNLQRAKTIEKKDLIEIELE
NGARLKSKTVIISTGARWRNVGVPGEEEFKNKGVTYCPHCDGPLFKGKHVAVIGGGNSGI
EAAIDLAGVASHVTVFEFMPELKADSVLQDRLYSLNNITVLKNVQTKEITGTDKVNGITY
IERDTGEIKHVELDGVFVQIGLVPNTDWLGETVDRNKSGEIIIDNHGATNVPGVFAAGDC
TNTPYKQIIISMGSGATAALGAFEYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactagataaagatataaaacaacaattagctcaatatcttgagcttatggaaggc
actgtacttataaaagtcagtgctgattccgatgatatatccaacactatggtttctctc
gtagatgaactagtttctatgtctccaaaaataaaagctgaaaaatcaaaattattaaga
actcctagctttagcataaatcgtactgatgaagaaactggtgtagcttttgcaggaatc
cctttaggacatgaatttaattcattagtactagctcttctacaagttagcggaagagcc
ccaaaaattgatcagaaaacaattgattcaattaagaacattaaaggagaataccatttt
gaaacttatattagtttaagctgtcataactgcccagaagttgttcaatctctaaattta
attagcatccttaatccaaaggtcactcatacaatgattgatggtgccgtttttaaagaa
gagatagaaagtaaaaatatacttgcagtaccatcagtttatttaaatggagaattcttt
gcaagtggccgcatgactatcgaagaaattcttgcaaaaatcggagaagccccagtttca
gaaaattttgcagataaagatccatacgatatgcttgttgttggcggcggtcctgcaggt
gcaagtgctgctatttatgcagctcgtaaaggcattcgtactggaattatcgttgaacgt
tttggtggtcaagtattagatactataggtattgaaaactttataagtattaaatataca
gaaggccctaaacttgcagcaagccttgaagagcatgtcaaagactataacgttgatata
gtaaacttacaacgtgctaagactatagaaaaaaaagaccttattgagattgaactagaa
aatggtgcacgtttaaagagtaaaacggtaataatttcgacaggtgcccgctggaggaat
gtcggtgttcctggagaagaagagttcaagaataaaggtgtgacatattgtcctcactgt
gatggccctttatttaaagggaaacatgttgcagtcatcggtggaggtaattcaggcatc
gaagctgccattgaccttgctggagttgctagtcacgtaactgtttttgaatttatgcca
gaacttaaagcagattcagttttgcaagatcgtctttacagtttgaataatataaccgtc
ttaaaaaatgttcagactaaagaaattactggaactgataaggtaaatggaattacctat
attgaacgtgacacaggagaaattaagcatgttgaattagatggtgtatttgtccaaatt
ggacttgtgccaaatactgattggttaggagaaacagtcgatcgtaataagtcaggcgaa
attataattgataaccatggtgctactaatgtaccaggagtatttgctgcaggagattgc
actaataccccatacaagcaaataattatttccatgggatcaggagcaacagctgcctta
ggtgcatttgaatatctaataagaaactaa

DBGET integrated database retrieval system