KEGG   Clostridium beijerinckii NCIMB 14988: LF65_02644Help
Entry
LF65_02644        CDS       T04773                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Pathway
cbei00010  Glycolysis / Gluconeogenesis
cbei00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LF65_02644
   00500 Starch and sucrose metabolism
    LF65_02644
Enzymes [BR:cbei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LF65_02644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AJG99217
UniProt: A0A0B5QMJ1
LinkDB All DBs
Position
2886294..2887709
Genome map
AA seq 471 aa AA seqDB search
MSIKFPEGFLWGGATAANQFEGAYNEDGKGLSTQDIAPKGVMGALTDEPTEDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPNGDDKEPNEKGLQFYDNVFDELAKYGIEP
LVTISHYETPLALAKNYDGWVNRKLIGFFENYVRTIFNRYKDKVKYWLTFNEINSATHFP
YMSAGIWTPKEQLNKQDLYQAMHHELVASALAVKIGHEINPKFKIGCMILGVPNYPLTPK
PSDVLKAMEADRENLFFGDVHVRGEYPRYMNRFFKENNIEIKMEPGDKEILKNTVDFVSF
SYYMSSCASADPEKKVKGKGNLIGGVPNPYLKASDWGWQIDPEGLRYMLNLFYDRYQKPL
FIVENGLGAVDELINDENGNKTVNDDYRINYLNDHLVQVGEAIEDGVEVMGYTTWGCIDL
VSASTAELKKRYGFIYVDRHDDGSGTLERYKKKSFYWYKEVIDTNGANLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattaaatttccagaaggatttttatggggaggagctacagctgctaaccaattt
gaaggtgcatataacgaagacggaaaaggattatctactcaggatatagcacctaaaggt
gtgatgggagctttaacagatgaaccaacagaagataatatgaaacttataggaattgat
ttttatcatagatataaagaagatattaagctatttgcagaaatgggcttcaaagttttc
agactatctattgcttggtcaagaatatttccaaatggtgatgataaagagcccaatgaa
aagggattacaattttatgataatgtatttgatgagttagctaagtatggaatagagcca
ctagttacaatttctcactatgagacaccacttgcactagctaagaattatgatggctgg
gtaaatagaaagctaataggatttttcgaaaactatgtaagaacaatatttaacagatat
aaagataaggtgaaatattggctaactttcaatgaaataaattctgcaactcatttccca
tatatgagtgctggaatatggacaccaaaagaacaattaaacaagcaggatttatatcag
gctatgcatcatgaactagtagcaagtgcacttgcagtaaaaattggtcatgaaataaat
ccaaaattcaaaattggatgcatgattcttggggtaccaaactatccattaacaccaaaa
ccaagtgatgtacttaaggcaatggaagctgatagggagaatcttttctttggagatgtt
catgtaagaggagaatatccaagatatatgaatagattttttaaggaaaacaacatagaa
ataaaaatggaacctggtgataaagaaatactaaagaatacagtagattttgtttcattt
agttattatatgagctcatgtgcaagtgcagatcctgaaaagaaggttaaaggaaaagga
aatctcattggaggagtaccaaatccatatttaaaggcttcagattggggatggcaaata
gatccagaaggattaagatacatgcttaacttattctatgacagatatcaaaaaccattg
tttatagttgaaaatggtttaggagctgttgacgaattaataaatgatgaaaatggaaat
aagacagtaaatgatgattatagaataaattacttaaatgatcacttagttcaagtagga
gaagctattgaagatggtgttgaagttatgggatacactacatggggatgcatagattta
gtcagtgcatcaacagctgaacttaaaaagagatacggattcatctatgtggatagacat
gatgatggaagtggaactctagaaagatataagaaaaagagcttttactggtataaagaa
gttattgatacaaatggagctaatttaaaaaaataa

DBGET integrated database retrieval system