KEGG   Clostridium beijerinckii NCIMB 14988: LF65_03506Help
Entry
LF65_03506        CDS       T04773                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LF65_03506
Enzymes [BR:cbei01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LF65_03506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_binding_3 FAD_oxidored Thi4 AlaDh_PNT_C NAD_binding_7 NAD_binding_8 K_oxygenase FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AJH00063
UniProt: A0A0B5QPY6
LinkDB All DBs
Position
complement(2626157..2627686)
Genome map
AA seq 509 aa AA seqDB search
MILDKDIKQQLAQYLELMEDTVLIKVSADSDDISNTMVSLVDELVSMSPKIKAEKSKLLR
TPSFSINRTDEETGVAFAGIPLGHEFNSLVLALLQVSGRAPKIDQKTIDSIKNIKGEYHF
ETYISLSCHNCPEVVQSLNLISILNPKVTHTMIDGAVFKEEIESKNILAVPSVYLNGEFF
ASGRMTIEEILAKIGEAPVSEDFADKDPYDVLVVGGGPAGASAAIYAARKGIRTGIIVER
FGGQVLDTIGIENFISIKYTEGPKLAASLEEHVKDYNVDIINLQRAKTLEKKDLIEIELE
NGARLKSKTVIISTGARWRNVGVPGEEEFKNKGVTYCPHCDGPLFKGKHVAVIGGGNSGI
EAAIDLAGVASHVTVFEFMTELKADSVLQDRLYSLNNITVLKNVQTKEITGTDKVNGITY
IERDTGEIKHIELDGVFVQIGLVPNTDWLGETVDRNKSGEIIIDNHGATNVPGVFAAGDC
TNTPYKQIIISMGSGATAALGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatactagataaagatataaaacaacaattagctcaatatcttgagcttatggaagac
actgtacttataaaagtcagtgctgattccgatgatatatccaatactatggtttctctc
gtagatgaactagtttctatgtctccaaaaataaaagctgaaaaatcaaagttattaaga
actcctagctttagcataaatcgtactgatgaagaaactggtgtagcttttgcaggaatc
cctttaggacatgaatttaattcattagtattagctcttctacaagttagcggaagagcc
ccaaaaattgatcagaaaacaattgattcaattaagaacattaagggagaataccatttt
gaaacttatattagtttaagctgtcataactgcccagaagttgttcaatctctaaattta
attagcatccttaatccaaaggtcactcatacaatgattgatggtgccgtttttaaagaa
gagatagaaagtaaaaatatacttgcagtaccatcagtttatttaaatggagaattcttt
gcaagtggccgcatgactatcgaagaaattcttgccaaaatcggagaagccccagtttca
gaagattttgcagataaagatccatacgatgtgcttgttgttggcggcggccctgcaggt
gcaagtgctgctatttatgccgcacgtaaaggcattcgtacaggaattatcgttgaacgt
tttggtggtcaagtattagatactataggtattgaaaactttataagtattaaatataca
gaaggccctaaacttgcagcaagtcttgaagagcatgttaaagactataacgttgatata
ataaacttacaacgtgctaagactctagaaaagaaagaccttattgagattgaactagaa
aatggtgcacgtttaaagagcaaaactgtaataatttctacgggtgcccgctggaggaat
gtcggagttcctggagaagaagagtttaagaataaaggtgtgacatattgtcctcactgt
gatggccctttgtttaaagggaaacatgttgcagtcatcggtggaggcaattcaggcatt
gaagctgccattgaccttgctggagttgctagccacgtaactgtttttgaatttatgaca
gaacttaaagcagattcagttttacaagatcgtctttacagtttaaataatataaccgtt
ttaaaaaatgttcagactaaagaaattactggcactgataaggtaaatggaattacctat
attgaacgtgacacaggagaaattaagcatattgaattagatggtgtatttgtccaaatt
ggacttgtgccaaatactgattggctaggagaaacagtcgatcgtaataagtcaggcgaa
attataattgataaccatggtgctactaatgtaccaggagtatttgctgcaggagactgc
actaataccccatacaagcaaataattatttccatgggatcaggagcaacagccgcctta
ggtgcatttgactatctaataagaaactaa

DBGET integrated database retrieval system