KEGG   Clostridium beijerinckii NCIMB 14988: LF65_05400
Entry
LF65_05400        CDS       T04773                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
cbei  Clostridium beijerinckii NCIMB 14988
Brite
KEGG Orthology (KO) [BR:cbei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LF65_05400
Enzymes [BR:cbei01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     LF65_05400
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AJH01919
UniProt: A0A0B5QY54
LinkDB
Position
complement(6043448..6044917)
AA seq 489 aa
MSVKNKVQLITYPDSLGGDLKALNNILKKYFLDIFKGGIHILPPFPSSGDRGFAPLTYLE
IEPKFGSWEDIKAIGENFDVLVDLMVNHISRQSEYFQDFLRKGRKSSYADLFITLDKLWM
DGKPVKEDIEKMFLRRTLPYSTFTIEENCEEEKVWTTFGKTDPSEQIDLDIKSEKVKHLL
TEFFENFKRNNVKIVRLDAVGYIIKKLGTSCFFVEPEIYEFMDWIMGLATSLDIELLPEV
HAHYSIQNKLAERGFWIYDFILPYTILDTLINNSSKKLKHYLKNRPSKQFTMLDCHDGIP
VKPDMDDLIDTEEARKLVNVCLERGSNLSLIVSDEHKAPDGFDVHQIRCSYYSVLNADDD
AYMAARAIQFFAPGIPQVYYVGLLAGENDYEAVKKNGEGREINRHNFSLEEVEQAIQKEV
VQRLLKLIRFRNEYEAFDGQFIVLDSAEDEVCLLWKKDSKECRLFVDLKTNKSEIEFVDN
SGGRSLYIV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtcagttaaaaataaagtacagcttataacatacccggactcattgggaggggattta
aaagcgctgaacaatatacttaagaaatattttttagatatttttaagggcgggattcat
attttgccaccattcccgtcatctggggatagggggtttgcaccgcttacctatctggaa
atagaacctaagtttggttcgtgggaagatatcaaagctataggagaaaattttgatgtt
ctggtagatttaatggttaaccatatttcaaggcaatctgaatattttcaggattttctt
agaaaaggcaggaaatcatcctatgcagatttatttataaccttggataagctttggatg
gatgggaagcctgttaaggaagatatagaaaaaatgtttcttagaagaactttaccgtac
tctacgttcactatagaagaaaattgcgaagaagaaaaggtatggactacttttgggaaa
actgatccatctgagcaaatcgatttggatataaaatcagaaaaggtaaaacatctattg
acagagttctttgaaaactttaaaagaaataacgttaagatagttaggctggatgcggtg
ggatatattattaaaaagcttggaacaagctgcttttttgttgagccagaaatatatgaa
tttatggactggattatgggtctagcaacttccttggatattgaacttctccctgaggtc
cacgcacattattcaattcaaaataaacttgcagaaagaggtttttggatttatgatttt
atccttccatatactatacttgatactcttataaataattccagcaaaaaattaaaacac
tatttaaaaaatcgtccaagcaagcagtttactatgctcgattgtcatgatggaattcca
gttaagccggatatggatgatctaattgacacagaagaggctagaaaattggtaaatgtg
tgccttgagagaggatctaacttaagtctaattgtgtcagatgaacataaggctccggat
ggatttgacgttcatcagattaggtgttcctactattcagtattaaatgcggatgatgat
gcatatatggctgctagagctatacaattctttgctccgggaatacctcaagtctattat
gtggggcttttagctggtgagaatgactatgaggctgtaaagaagaacggtgagggccgc
gaaataaaccgtcataattttagcttagaggaagtcgaacaagcaattcaaaaggaagta
gtacaaagacttttaaagctcataagatttaggaatgagtacgaagcgttcgatggccaa
tttattgttttagattctgccgaagacgaagtgtgtcttttatggaaaaaggatagtaag
gagtgtagattatttgttgatttgaaaactaataagtcagaaatagagttcgttgataat
agtggtggtagaagtctatatattgtatag

DBGET integrated database retrieval system